DRD2 (англ. Dopamine receptor D2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми. Довжина поліпептидного ланцюга білка становить 443 амінокислот, а молекулярна маса — 50 619.
DRD2 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | DRD2, D2DR, D2R, dopamine receptor D2 | ||||||||||||||||
Зовнішні ІД | OMIM: 126450 MGI: 94924 HomoloGene: 22561 GeneCards: DRD2 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
великий депресивний розлад | |||||||||||||||||
Реагує на сполуку | |||||||||||||||||
remoxipride | |||||||||||||||||
benzquinamide, LP-12, LP-211, LP-44, ропінірол, ротиготин, vilazodone, 7-hydroxy-2-(di-N-propylamino)tetralin, бромокриптин, дофамін, pergolide, праміпексол, quinelorane, quinpirole, sumanirole, апоморфін, арипіпразол, brexpiprazole, каберголін, lisuride, пірибедил, roxindole, terguride, амісульприд, blonanserin, (+)-butaclamol, хлорпромазин, клозапін, домперидон, eticlopride, флюпентиксол, Флуфеназин, галоперидол, L-741,626, Локсапін, mesoridazine, nafadotride, оланзапін, perospirone, перфеназин, пімозид, pipotiazine, прохлорперазин, промазин, кветіапін, raclopride, рисперидон, сертиндол, сульпірид, levosulpiride, Трифлуоперазин, зипразидон, zotepine | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 11: 113.41 – 113.48 Mb | Хр. 9: 49.25 – 49.32 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MDPLNLSWYD | DDLERQNWSR | PFNGSDGKAD | RPHYNYYATL | LTLLIAVIVF | ||||
GNVLVCMAVS | REKALQTTTN | YLIVSLAVAD | LLVATLVMPW | VVYLEVVGEW | ||||
KFSRIHCDIF | VTLDVMMCTA | SILNLCAISI | DRYTAVAMPM | LYNTRYSSKR | ||||
RVTVMISIVW | VLSFTISCPL | LFGLNNADQN | ECIIANPAFV | VYSSIVSFYV | ||||
PFIVTLLVYI | KIYIVLRRRR | KRVNTKRSSR | AFRAHLRAPL | KGNCTHPEDM | ||||
KLCTVIMKSN | GSFPVNRRRV | EAARRAQELE | MEMLSSTSPP | ERTRYSPIPP | ||||
SHHQLTLPDP | SHHGLHSTPD | SPAKPEKNGH | AKDHPKIAKI | FEIQTMPNGK | ||||
TRTSLKTMSR | RKLSQQKEKK | ATQMLAIVLG | VFIICWLPFF | ITHILNIHCD | ||||
CNIPPVLYSA | FTWLGYVNSA | VNPIIYTTFN | IEFRKAFLKI | LHC |
Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, . Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані.
Література
- Selbie L.A., Hayes G., Shine J. (1989). The major dopamine D2 receptor: molecular analysis of the human D2A subtype. DNA. 8: 683—689. PMID 2533064 DOI:10.1089/dna.1.1989.8.683
- Robakis N.K., Mohamadi M., Fu D.Y., Sambamurti K., Refolo L.M. (1990). Human retina D2 receptor cDNAs have multiple polyadenylation sites and differ from a pituitary clone at the 5' non-coding region. Nucleic Acids Res. 18: 1299—1299. PMID 2138729 DOI:10.1093/nar/18.5.1299
- Dearry A., Falardeau P., Shores C., Caron M.G. (1991). D2 dopamine receptors in the human retina: cloning of cDNA and localization of mRNA. Cell. Mol. Neurobiol. 11: 437—453. PMID 1835903 DOI:10.1007/BF00734808
- Seeman P., Nam D., Ulpian C., Liu I.S.C., Tallerico T. (2000). New dopamine receptor, D2(Longer), with unique TG splice site, in human brain. Brain Res. Mol. Brain Res. 76: 132—141. PMID 10719223 DOI:10.1016/S0169-328X(99)00343-5
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Binda A.V., Kabbani N., Levenson R. (2005). Regulation of dense core vesicle release from PC12 cells by interaction between the D2 dopamine receptor and calcium-dependent activator protein for secretion (CAPS). Biochem. Pharmacol. 69: 1451—1461. PMID 15857609 DOI:10.1016/j.bcp.2005.02.015
Примітки
- Захворювання, генетично пов'язані з DRD2 переглянути/редагувати посилання на ВікіДаних.
- Сполуки, які фізично взаємодіють з Dopamine receptor D2, isoform CRA_c переглянути/редагувати посилання на ВікіДаних.
- Сполуки, які фізично взаємодіють з dopamine receptor D2 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 12 серпня 2016. Процитовано 8 вересня 2017.
- (англ.) . Архів оригіналу за 8 вересня 2017. Процитовано 8 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
DRD2 angl Dopamine receptor D2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 11 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 443 aminokislot a molekulyarna masa 50 619 DRD2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB6CM4IdentifikatoriSimvoliDRD2 D2DR D2R dopamine receptor D2Zovnishni ID OMIM 126450 MGI 94924 HomoloGene 22561 GeneCards DRD2Pov yazani genetichni zahvoryuvannyavelikij depresivnij rozlad Reaguye na spolukuremoxipride benzquinamide LP 12 LP 211 LP 44 ropinirol rotigotin vilazodone 7 hydroxy 2 di N propylamino tetralin bromokriptin dofamin pergolide pramipeksol quinelorane quinpirole sumanirole apomorfin aripiprazol brexpiprazole kabergolin lisuride piribedil roxindole terguride amisulprid blonanserin butaclamol hlorpromazin klozapin domperidon eticlopride flyupentiksol Flufenazin galoperidol L 741 626 Loksapin mesoridazine nafadotride olanzapin perospirone perfenazin pimozid pipotiazine prohlorperazin promazin kvetiapin raclopride risperidon sertindol sulpirid levosulpiride Trifluoperazin ziprazidon zotepine Ontologiya genaMolekulyarna funkciya protein homodimerization activity potassium channel regulator activity dopamine neurotransmitter receptor activity coupled via Gi Go identical protein binding dopamine neurotransmitter receptor activity G protein coupled receptor activity GO 0001948 GO 0016582 protein binding signal transducer activity adrenergic receptor activity dopamine binding signaling receptor binding ionotropic glutamate receptor binding protein heterodimerization activityKlitinna komponenta GO 0016023 cytoplasmic vesicle sperm flagellum endocytic vesicle Akrosoma dendritic spine synaptic vesicle membrane perikarion klitinna membrana dendrit nejrobiologiya ciliary membrane axon terminus integral component of membrane GO 0097483 GO 0097481 postsinaptichne ushilnennya membrana lateral plasma membrane akson vnutrishnoklitinnij non motile cilium integral component of plasma membrane dopaminergic synapse glutamatergic synapse GABA ergic synapse integral component of postsynaptic membrane integral component of presynaptic membraneBiologichnij proces negative regulation of cell population proliferation temperature homeostasis adenylate cyclase inhibiting dopamine receptor signaling pathway adenohypophysis development circadian regulation of gene expression response to toxic substance regulation of dopamine secretion response to cocaine response to amphetamine sensory perception of smell locomotory behavior positive regulation of urine volume response to ethanol aksonogeneza response to inactivity phospholipase C activating dopamine receptor signaling pathway modulation of chemical synaptic transmission marafet negative regulation of protein kinase B signaling associative learning positive regulation of cytosolic calcium ion concentration involved in phospholipase C activating G protein coupled signaling pathway regulation of dopamine uptake involved in synaptic transmission regulation of synaptic transmission GABAergic positive regulation of dopamine uptake involved in synaptic transmission GO 0072468 signalna transdukciya Wnt signaling pathway adult walking behavior branching morphogenesis of a nerve negative regulation of cytosolic calcium ion concentration negative regulation of innate immune response regulation of phosphoprotein phosphatase activity acid secretion harchova povedinka positive regulation of G protein coupled receptor signaling pathway response to axon injury striatum development synaptic transmission dopaminergic nervous system process involved in regulation of systemic arterial blood pressure peristaltika regulation of long term neuronal synaptic plasticity activation of protein kinase activity positive regulation of growth hormone secretion regulation of sodium ion transport forebrain development response to light stimulus orbitofrontal cortex development prepulse inhibition response to morphine response to iron ion positive regulation of ERK1 and ERK2 cascade dovgotrivala pam yat positive regulation of renal sodium excretion negative regulation of insulin secretion neuron neuron synaptic transmission GO 0007243 intracellular signal transduction auditory behavior behavioral response to ethanol regulyaciya sercevogo ritmu adenylate cyclase activating adrenergic receptor signaling pathway positive regulation of cytokinesis regulation of potassium ion transport pigmentation cellular calcium ion homeostasis dopamine metabolic process response to nicotine regulation of MAPK cascade response to histamine negative regulation of synaptic transmission glutamatergic response to hypoxia negative regulation of circadian sleep wake cycle sleep negative regulation of protein secretion synapse assembly regulation of locomotion involved in locomotory behavior dopamine receptor signaling pathway negative regulation of dopamine receptor signaling pathway perelyak positive regulation of receptor internalization GO 0034613 protein localization arachidonic acid secretion GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II G protein coupled receptor internalization positive regulation of multicellular organism growth positive regulation of long term synaptic potentiation negative regulation of dopamine secretion adult behavior cerebral cortex GABAergic interneuron migration regulation of synapse structural plasticity adenylate cyclase modulating G protein coupled receptor signaling pathway visual learning negative regulation of cell migration behavioral response to cocaine positive regulation of neuroblast proliferation negative regulation of blood pressure release of sequestered calcium ion into cytosol negative regulation of voltage gated calcium channel activity G protein coupled receptor signaling pathway negative regulation of adenylate cyclase activity excitatory postsynaptic potential GO 0033128 negative regulation of protein phosphorylation avtofagiya positive regulation of neurogenesis negative regulation of cell death drinking behavior adrenergic receptor signaling pathway regulation of neurotransmitter uptake postsynaptic modulation of chemical synaptic transmission regulation of synaptic vesicle exocytosisDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1813 13489Ensembl ENSG00000149295 ENSMUSG00000032259UniProt P14416 P61168RefSeq mRNK NM 016574 NM 000795NM 010077RefSeq bilok NP 000786 NP 057658 NP 000786 1NP 034207Lokus UCSC Hr 11 113 41 113 48 MbHr 9 49 25 49 32 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVF GNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEW KFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKR RVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYV PFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDM KLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGK TRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCD CNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv g bilokspryazhenih receptoriv Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Lokalizovanij u klitinnij membrani membrani LiteraturaSelbie L A Hayes G Shine J 1989 The major dopamine D2 receptor molecular analysis of the human D2A subtype DNA 8 683 689 PMID 2533064 DOI 10 1089 dna 1 1989 8 683 Robakis N K Mohamadi M Fu D Y Sambamurti K Refolo L M 1990 Human retina D2 receptor cDNAs have multiple polyadenylation sites and differ from a pituitary clone at the 5 non coding region Nucleic Acids Res 18 1299 1299 PMID 2138729 DOI 10 1093 nar 18 5 1299 Dearry A Falardeau P Shores C Caron M G 1991 D2 dopamine receptors in the human retina cloning of cDNA and localization of mRNA Cell Mol Neurobiol 11 437 453 PMID 1835903 DOI 10 1007 BF00734808 Seeman P Nam D Ulpian C Liu I S C Tallerico T 2000 New dopamine receptor D2 Longer with unique TG splice site in human brain Brain Res Mol Brain Res 76 132 141 PMID 10719223 DOI 10 1016 S0169 328X 99 00343 5 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Binda A V Kabbani N Levenson R 2005 Regulation of dense core vesicle release from PC12 cells by interaction between the D2 dopamine receptor and calcium dependent activator protein for secretion CAPS Biochem Pharmacol 69 1451 1461 PMID 15857609 DOI 10 1016 j bcp 2005 02 015PrimitkiZahvoryuvannya genetichno pov yazani z DRD2 pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z Dopamine receptor D2 isoform CRA c pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z dopamine receptor D2 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 12 serpnya 2016 Procitovano 8 veresnya 2017 angl Arhiv originalu za 8 veresnya 2017 Procitovano 8 veresnya 2017 Div takozhHromosoma 11 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi