SMAD3 (англ. SMAD family member 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми. Довжина поліпептидного ланцюга білка становить 425 амінокислот, а молекулярна маса — 48 081.
SMAD3 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | SMAD3, HSPC193, HsT17436, JV15-2, LDS1C, LDS3, MADH3, SMAD family member 3 | ||||||||||||||||
Зовнішні ІД | OMIM: 603109 MGI: 1201674 HomoloGene: 55937 GeneCards: SMAD3 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
запальні захворювання кишківника, Хвороба Крона, бронхіальна астма, ішемічна хвороба серця, колоректальний рак, aneurysm-osteoarthritis syndrome | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 15: 67.06 – 67.2 Mb | Хр. 9: 63.55 – 63.67 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MSSILPFTPP | IVKRLLGWKK | GEQNGQEEKW | CEKAVKSLVK | KLKKTGQLDE | ||||
LEKAITTQNV | NTKCITIPRS | LDGRLQVSHR | KGLPHVIYCR | LWRWPDLHSH | ||||
HELRAMELCE | FAFNMKKDEV | CVNPYHYQRV | ETPVLPPVLV | PRHTEIPAEF | ||||
PPLDDYSHSI | PENTNFPAGI | EPQSNIPETP | PPGYLSEDGE | TSDHQMNHSM | ||||
DAGSPNLSPN | PMSPAHNNLD | LQPVTYCEPA | FWCSISYYEL | NQRVGETFHA | ||||
SQPSMTVDGF | TDPSNSERFC | LGLLSNVNRN | AAVELTRRHI | GRGVRLYYIG | ||||
GEVFAECLSD | SAIFVQSPNC | NQRYGWHPAT | VCKIPPGCNL | KIFNNQEFAA | ||||
LLAQSVNQGF | EAVYQLTRMC | TIRMSFVKGW | GAEYRRQTVT | STPCWIELHL | ||||
NGPLQWLDKV | LTQMGSPSIR | CSSVS |
Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.
Література
- Zhang Y., Feng X.-H., Wu R.-Y., Derynck R. (1996). Receptor-associated Mad homologues synergize as effectors of the TGF-beta response. Nature. 383: 168—172. PMID 8774881 DOI:10.1038/383168a0
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Tsukazaki T., Chiang T.A., Davison A.F., Attisano L., Wrana J.L. (1998). SARA, a FYVE domain protein that recruits Smad2 to the TGFbeta receptor. Cell. 95: 779—791. PMID 9865696 DOI:10.1016/S0092-8674(00)81701-8
- Kawabata M., Inoue H., Hanyu A., Imamura T., Miyazono K. (1998). Smad proteins exist as monomers in vivo and undergo homo- and hetero-oligomerization upon activation by serine/threonine kinase receptors. EMBO J. 17: 4056—4065. PMID 9670020 DOI:10.1093/emboj/17.14.4056
- Zhang Y., Feng X.H., Derynck R. (1998). Smad3 and Smad4 cooperate with c-Jun/c-Fos to mediate TGF-beta-induced transcription. Nature. 394: 909—913. PMID 9732876 DOI:10.1038/29814
- Lebrun J.J., Takabe K., Chen Y., Vale W. (1999). Roles of pathway-specific and inhibitory Smads in activin receptor signaling. Mol. Endocrinol. 13: 15—23. PMID 9892009 DOI:10.1210/mend.13.1.0218
Примітки
- Захворювання, генетично пов'язані з SMAD3 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:6769 (англ.) . Процитовано 11 вересня 2017.
- (англ.) . Архів оригіналу за 5 вересня 2017. Процитовано 11 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
SMAD3 angl SMAD family member 3 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 15 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 425 aminokislot a molekulyarna masa 48 081 SMAD3Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2LB2 1MHD 1MJS 1MK2 1OZJ 1U7F 2LAJ 5OD6 5ODGIdentifikatoriSimvoliSMAD3 HSPC193 HsT17436 JV15 2 LDS1C LDS3 MADH3 SMAD family member 3Zovnishni ID OMIM 603109 MGI 1201674 HomoloGene 55937 GeneCards SMAD3Pov yazani genetichni zahvoryuvannyazapalni zahvoryuvannya kishkivnika Hvoroba Krona bronhialna astma ishemichna hvoroba sercya kolorektalnij rak aneurysm osteoarthritis syndrome Ontologiya genaMolekulyarna funkciya phosphatase binding GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity R SMAD binding co SMAD binding RNA polymerase II transcription regulatory region sequence specific DNA binding transcription factor binding zv yazuvannya z ionom metalu GO 0000980 RNA polymerase II cis regulatory region sequence specific DNA binding enzyme binding transforming growth factor beta receptor binding protein homodimerization activity collagen binding zinc ion binding chromatin binding GO 0001158 cis regulatory region sequence specific DNA binding GO 0001948 GO 0016582 protein binding double stranded DNA binding protein kinase binding sequence specific DNA binding DNA binding bHLH transcription factor binding ubiquitin binding identical protein binding protein heterodimerization activity chromatin DNA binding ubiquitin protein ligase binding beta catenin binding GO 0000983 RNA polymerase II general transcription initiation factor activity DEAD H box RNA helicase binding mineralocorticoid receptor binding glucocorticoid receptor binding primary miRNA binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific SMAD binding GO 0001077 GO 0001212 GO 0001213 GO 0001211 GO 0001205 DNA binding transcription activator activity RNA polymerase II specific GO 0001104 transcription coregulator activityKlitinna komponenta citoplazma klitinne yadro heteromeric SMAD protein complex SMAD protein complex transcription regulator complex receptor complex klitinna membrana vnutrishnoklitinnij nukleoplazma nuclear inner membrane gialoplazma GO 0009327 protein containing complexBiologichnij proces somitogenesis skeletal system development ureteric bud development endoderm development regulation of transforming growth factor beta2 production embryonic pattern specification GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II negative regulation of osteoblast differentiation heart looping positive regulation of chondrocyte differentiation positive regulation of alkaline phosphatase activity positive regulation of interleukin 1 beta production pericardium development regulation of binding negative regulation of wound healing activation of cysteine type endopeptidase activity involved in apoptotic process transforming growth factor beta receptor signaling pathway negative regulation of inflammatory response positive regulation of positive chemotaxis negative regulation of cell population proliferation negative regulation of fat cell differentiation cell cell junction organization GO 0009373 regulation of transcription DNA templated extrinsic apoptotic signaling pathway activation of cysteine type endopeptidase activity involved in apoptotic signaling pathway signal transduction involved in regulation of gene expression in utero embryonic development negative regulation of transforming growth factor beta receptor signaling pathway nodal signaling pathway GO 0060469 GO 0009371 positive regulation of transcription DNA templated negative regulation of cell growth regulation of immune response positive regulation of transforming growth factor beta3 production T cell activation activin receptor signaling pathway regulation of striated muscle tissue development embryonic foregut morphogenesis positive regulation of bone mineralization Zagoyennya ran negative regulation of apoptotic process positive regulation of extracellular matrix assembly GO 1901227 negative regulation of transcription by RNA polymerase II positive regulation of epithelial to mesenchymal transition GO 0019049 GO 0030683 mitigation of host defenses by virus thyroid gland development developmental growth lens fiber cell differentiation gastrulyaciya GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid osteoblast differentiation GO 1990744 GO 1990729 primary miRNA processing negative regulation of osteoblast proliferation osteoblast development embryonic cranial skeleton morphogenesis transdifferentiation paraxial mesoderm morphogenesis response to hypoxia positive regulation of cell migration mesoderm formation regulation of transforming growth factor beta receptor signaling pathway GO 1901313 positive regulation of gene expression immune system development positive regulation of focal adhesion assembly liver development regulation of epithelial cell proliferation positive regulation of stress fiber assembly GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II negative regulation of mitotic cell cycle negative regulation of cytosolic calcium ion concentration canonical Wnt signaling pathway protein stabilization transcription DNA templated GO 1903363 negative regulation of protein catabolic process protein deubiquitination positive regulation of nitric oxide biosynthetic process negative regulation of lung blood pressure positive regulation of pri miRNA transcription by RNA polymerase II negative regulation of cardiac muscle hypertrophy in response to stress cellular response to transforming growth factor beta stimulus cellular response to cytokine stimulus positive regulation of protein import into nucleus positive regulation of DNA binding transcription factor activity SMAD protein signal transduction positive regulation of canonical Wnt signaling pathway SMAD protein complex assembly adrenal gland developmentDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez4088 17127Ensembl ENSG00000166949 ENSMUSG00000032402UniProt P84022 Q8BUN5RefSeq mRNK NM 001145102 NM 001145103 NM 001145104 NM 005902NM 016769RefSeq bilok NP 001138574 NP 001138575 NP 001138576 NP 005893NP 058049Lokus UCSC Hr 15 67 06 67 2 MbHr 9 63 55 63 67 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDE LEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSH HELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEF PPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSM DAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHA SQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAA LLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHL NGPLQWLDKVLTQMGSPSIRCSSVS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi acetilyuvannya alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom cinku DNK Lokalizovanij u citoplazmi yadri LiteraturaZhang Y Feng X H Wu R Y Derynck R 1996 Receptor associated Mad homologues synergize as effectors of the TGF beta response Nature 383 168 172 PMID 8774881 DOI 10 1038 383168a0 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Tsukazaki T Chiang T A Davison A F Attisano L Wrana J L 1998 SARA a FYVE domain protein that recruits Smad2 to the TGFbeta receptor Cell 95 779 791 PMID 9865696 DOI 10 1016 S0092 8674 00 81701 8 Kawabata M Inoue H Hanyu A Imamura T Miyazono K 1998 Smad proteins exist as monomers in vivo and undergo homo and hetero oligomerization upon activation by serine threonine kinase receptors EMBO J 17 4056 4065 PMID 9670020 DOI 10 1093 emboj 17 14 4056 Zhang Y Feng X H Derynck R 1998 Smad3 and Smad4 cooperate with c Jun c Fos to mediate TGF beta induced transcription Nature 394 909 913 PMID 9732876 DOI 10 1038 29814 Lebrun J J Takabe K Chen Y Vale W 1999 Roles of pathway specific and inhibitory Smads in activin receptor signaling Mol Endocrinol 13 15 23 PMID 9892009 DOI 10 1210 mend 13 1 0218PrimitkiZahvoryuvannya genetichno pov yazani z SMAD3 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 6769 angl Procitovano 11 veresnya 2017 angl Arhiv originalu za 5 veresnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 15 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi