Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
PPARG (англ. Peroxisome proliferator activated receptor gamma) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. Довжина поліпептидного ланцюга білка становить 505 амінокислот, а молекулярна маса — 57 620.
| PPARG | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
 | |||||||||||||||||
| |||||||||||||||||
| Ідентифікатори | |||||||||||||||||
| Символи | PPARG, CIMT1, GLM1, NR1C3, PPARG1, PPARG2, PPARgamma, peroxisome proliferator activated receptor gamma, PPARG5 | ||||||||||||||||
| Зовнішні ІД | OMIM: 601487 MGI: 97747 HomoloGene: 7899 GeneCards: PPARG | ||||||||||||||||
| Пов'язані генетичні захворювання | |||||||||||||||||
| цукровий діабет 2-го типу, familial partial lipodystrophy, цукровий діабет | |||||||||||||||||
| Реагує на сполуку | |||||||||||||||||
| Розиглітазон, ciglitazone, лінолева кислота, месалазин, netoglitazone, Піоглітазон, Троглітазон, farglitazar, індометацин, bexarotene, bardoxolone methyl, диклофенак, Резвератрол | |||||||||||||||||
| |||||||||||||||||
| Шаблон експресії | |||||||||||||||||
 | |||||||||||||||||
| Більше даних | |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 3: 12.29 – 12.43 Mb | Хр. 6: 115.34 – 115.47 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MGETLGDSPI | DPESDSFTDT | LSANISQEMT | MVDTEMPFWP | TNFGISSVDL | ||||
| SVMEDHSHSF | DIKPFTTVDF | SSISTPHYED | IPFTRTDPVV | ADYKYDLKLQ | ||||
| EYQSAIKVEP | ASPPYYSEKT | QLYNKPHEEP | SNSLMAIECR | VCGDKASGFH | ||||
| YGVHACEGCK | GFFRRTIRLK | LIYDRCDLNC | RIHKKSRNKC | QYCRFQKCLA | ||||
| VGMSHNAIRF | GRMPQAEKEK | LLAEISSDID | QLNPESADLR | ALAKHLYDSY | ||||
| IKSFPLTKAK | ARAILTGKTT | DKSPFVIYDM | NSLMMGEDKI | KFKHITPLQE | ||||
| QSKEVAIRIF | QGCQFRSVEA | VQEITEYAKS | IPGFVNLDLN | DQVTLLKYGV | ||||
| HEIIYTMLAS | LMNKDGVLIS | EGQGFMTREF | LKSLRKPFGD | FMEPKFEFAV | ||||
| KFNALELDDS | DLAIFIAVII | LSGDRPGLLN | VKPIEDIQDN | LLQALELQLK | ||||
| LNHPESSQLF | AKLLQKMTDL | RQIVTEHVQL | LQVIKKTETD | MSLHPLLQEI | ||||
| YKDLY |
Кодований геном білок за функціями належить до рецепторів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, біологічні ритми, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.
Література
- Mukherjee R., Jow L., Croston G.E., Paterniti J.R. Jr. (1997). Identification, characterization, and tissue distribution of human peroxisome proliferator-activated receptor (PPAR) isoforms PPARgamma2 versus PPARgamma1 and activation with retinoid X receptor agonists and antagonists. J. Biol. Chem. 272: 8071—8076. PMID 9065481 DOI:10.1074/jbc.272.12.8071
- Lambe K.G., Tugwood J.D. (1996). A human peroxisome-proliferator-activated receptor-gamma is activated by inducers of adipogenesis, including thiazolidinedione drugs. Eur. J. Biochem. 239: 1—7. PMID 8706692 DOI:10.1111/j.1432-1033.1996.0001u.x
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Caira F., Antonson P., Pelto-Huikko M., Treuter E., Gustafsson J.-A. (2000). Cloning and characterization of RAP250, a nuclear receptor coactivator. J. Biol. Chem. 275: 5308—5317. PMID 10681503 DOI:10.1074/jbc.275.8.5308
- Shao W., Halachmi S., Brown M. (2002). ERAP140, a conserved tissue-specific nuclear receptor coactivator. Mol. Cell. Biol. 22: 3358—3372. PMID 11971969 DOI:10.1128/MCB.22.10.3358-3372.2002
- Park U.H., Yoon S.K., Park T., Kim E.J., Um S.J. (2011). Additional sex comb-like (ASXL) proteins 1 and 2 play opposite roles in adipogenesis via reciprocal regulation of peroxisome proliferator-activated receptor {gamma}. J. Biol. Chem. 286: 1354—1363. PMID 21047783 DOI:10.1074/jbc.M110.177816
Примітки
- Захворювання, генетично пов'язані з PPARG переглянути/редагувати посилання на ВікіДаних.
- Сполуки, які фізично взаємодіють з Peroxisome proliferator activated receptor gamma переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:9236 (англ.) . Процитовано 30 серпня 2017.
- (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 30 серпня 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
PPARG angl Peroxisome proliferator activated receptor gamma bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 3 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 505 aminokislot a molekulyarna masa 57 620 PPARGNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1FM6 1FM9 1I7I 1K74 1KNU 1NYX 1PRG 1RDT 1WM0 1ZEO 1ZGY 2ATH 2F4B 2FVJ 2G0G 2G0H 2GTK 2HFP 2HWQ 2HWR 2I4J 2I4P 2I4Z 2OM9 2P4Y 2POB 2PRG 2Q59 2Q5P 2Q5S 2Q61 2Q6R 2Q6S 2Q8S 2QMV 2VSR 2VST 2VV0 2VV1 2VV2 2VV3 2VV4 2XKW 2YFE 2ZK0 2ZK1 2ZK2 2ZK3 2ZK4 2ZK5 2ZK6 2ZNO 2ZVT 3ADS 3ADT 3ADU 3ADV 3ADW 3ADX 3AN3 3AN4 3B0Q 3B0R 3B1M 3B3K 3BC5 3CDP 3CDS 3CS8 3CWD 3D6D 3DZU 3DZY 3E00 3ET0 3ET3 3FEJ 3FUR 3G9E 3GBK 3H0A 3HO0 3HOD 3IA6 3K8S 3KMG 3LMP 3NOA 3OSI 3OSW 3PBA 3PO9 3PRG 3QT0 3R5N 3R8A 3R8I 3S9S 3SZ1 3T03 3TY0 3U9Q 3V9T 3V9V 3V9Y 3VJH 3VJI 3VN2 3VSO 3VSP 3WJ4 3WJ5 3WMH 3X1H 3X1I 4A4V 4A4W 4CI5 4E4K 4E4Q 4EM9 4EMA 4F9M 4FGY 4HEE 4JAZ 4JL4 4L96 4L98 4O8F 4OJ4 4PRG 4PVU 4PWL 4R2U 4R6S 4XLD 4R06 4Y29 4XTA 4XUM 4YT1 4XUH 5F9B 5AZVIdentifikatoriSimvoliPPARG CIMT1 GLM1 NR1C3 PPARG1 PPARG2 PPARgamma peroxisome proliferator activated receptor gamma PPARG5Zovnishni ID OMIM 601487 MGI 97747 HomoloGene 7899 GeneCards PPARGPov yazani genetichni zahvoryuvannyacukrovij diabet 2 go tipu familial partial lipodystrophy cukrovij diabet Reaguye na spolukuRoziglitazon ciglitazone linoleva kislota mesalazin netoglitazone Pioglitazon Troglitazon farglitazar indometacin bexarotene bardoxolone methyl diklofenak Rezveratrol Ontologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein binding alpha actinin binding chromatin binding prostaglandin receptor activity core promoter sequence specific DNA binding enzyme binding protein phosphatase binding zv yazuvannya z ionom metalu arachidonic acid binding nuclear receptor coactivator activity steroid hormone receptor activity sequence specific DNA binding identical protein binding GO 0038050 GO 0004886 GO 0038051 nuclear receptor activity GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity DNA binding double stranded DNA binding protein C terminus binding zinc ion binding peptidnij zv yazok protein self association retinoid X receptor binding protein heterodimerization activity DNA binding domain binding LBD domain binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific transcription factor binding estrogen receptor binding E box binding GO 0000975 transcription cis regulatory region binding RNA polymerase II transcription regulatory region sequence specific DNA binding GO 0001078 GO 0001214 GO 0001206 DNA binding transcription repressor activity RNA polymerase II specific fatty acid binding lipid binding signaling receptor activityKlitinna komponenta gialoplazma RNA polymerase II transcription regulator complex perinuclear region of cytoplasm citoplazma klitinne yadro vnutrishnoklitinna membranna organela nukleoplazma GO 0009327 protein containing complexBiologichnij proces negative regulation of cell population proliferation epithelial cell differentiation negative regulation of smooth muscle cell proliferation positive regulation of oligodendrocyte differentiation transcription DNA templated activation of cysteine type endopeptidase activity involved in apoptotic process response to lipid placenta development cellular response to vitamin E negative regulation of interferon gamma mediated signaling pathway negative regulation of sequestering of triglyceride regulation of fat cell differentiation cellular response to retinoic acid glucose homeostasis negative regulation of collagen biosynthetic process cellular response to hyperoxia response to estrogen regulation of cholesterol transporter activity regulation of circadian rhythm negative regulation of telomerase activity GO 0072468 signalna transdukciya cellular response to insulin stimulus monocyte differentiation GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II regulation of blood pressure positive regulation of apoptotic process positive regulation of fat cell differentiation negative regulation of cholesterol storage GO 0009373 regulation of transcription DNA templated negative regulation of cell growth GO 0045996 negative regulation of transcription DNA templated cellular response to prostaglandin stimulus animal organ regeneration positive regulation of DNA binding transcription factor activity lipoprotein transport response to metformin heart development response to cold negative regulation of acute inflammatory response fatty acid oxidation lipid homeostasis transcription initiation from RNA polymerase II promoter response to vitamin A vrodzhenij imunitet response to retinoic acid cell maturation cell fate commitment peroxisome proliferator activated receptor signaling pathway ritmichnij proces response to mechanical stimulus long chain fatty acid transport lipid metabolism response to caffeine positive regulation of fatty acid oxidation response to immobilization stress positive regulation of phagocytosis engulfment negative regulation of pancreatic stellate cell proliferation response to starvation GO 1904578 response to organic cyclic compound regulation of lipid metabolic process steroid hormone mediated signaling pathway response to organic substance response to nutrient cellular response to prostaglandin E stimulus GO 1901227 negative regulation of transcription by RNA polymerase II white fat cell differentiation negative regulation of macrophage derived foam cell differentiation GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II G protein coupled receptor signaling pathway macrophage derived foam cell differentiation positive regulation of DNA binding GO 0060469 GO 0009371 positive regulation of transcription DNA templated negative regulation of angiogenesis negative regulation of blood vessel endothelial cell migration pri miRNA transcription by RNA polymerase II GO 1905617 negative regulation of gene silencing by miRNA cellular response to low density lipoprotein particle stimulus positive regulation of vascular associated smooth muscle cell apoptotic process negative regulation of vascular endothelial cell proliferation negative regulation of vascular associated smooth muscle cell proliferation fatty acid metabolic process multicellular organism development hormone mediated signaling pathway diferenciaciya klitin intracellular receptor signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5468 19016Ensembl ENSG00000132170 ENSMUSG00000000440UniProt P37231 P37238RefSeq mRNK NM 005037 NM 015869 NM 138711 NM 138712 NM 001330615NM 001354666 NM 001354667 NM 001354668 NM 001354669 NM 001354670 NM 001374261 NM 001374262 NM 001374263 NM 001374264 NM 001374265 NM 001374266NM 001127330 NM 011146 NM 001308352 NM 001308354RefSeq bilok NP 001317544 NP 005028 NP 056953 NP 619725 NP 619726NP 001341595 NP 001341596 NP 001341597 NP 001341598 NP 001341599 NP 001361190 NP 001361191 NP 001361192 NP 001361193 NP 001361194 NP 001361195NP 001120802 NP 001295281 NP 001295283 NP 035276Lokus UCSC Hr 3 12 29 12 43 MbHr 6 115 34 115 47 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDL SVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQ EYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFH YGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLA VGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSY IKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGV HEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAV KFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLK LNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEI YKDLY A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv aktivatoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi biologichni ritmi polimorfizm alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom cinku DNK Lokalizovanij u citoplazmi yadri LiteraturaMukherjee R Jow L Croston G E Paterniti J R Jr 1997 Identification characterization and tissue distribution of human peroxisome proliferator activated receptor PPAR isoforms PPARgamma2 versus PPARgamma1 and activation with retinoid X receptor agonists and antagonists J Biol Chem 272 8071 8076 PMID 9065481 DOI 10 1074 jbc 272 12 8071 Lambe K G Tugwood J D 1996 A human peroxisome proliferator activated receptor gamma is activated by inducers of adipogenesis including thiazolidinedione drugs Eur J Biochem 239 1 7 PMID 8706692 DOI 10 1111 j 1432 1033 1996 0001u x The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Caira F Antonson P Pelto Huikko M Treuter E Gustafsson J A 2000 Cloning and characterization of RAP250 a nuclear receptor coactivator J Biol Chem 275 5308 5317 PMID 10681503 DOI 10 1074 jbc 275 8 5308 Shao W Halachmi S Brown M 2002 ERAP140 a conserved tissue specific nuclear receptor coactivator Mol Cell Biol 22 3358 3372 PMID 11971969 DOI 10 1128 MCB 22 10 3358 3372 2002 Park U H Yoon S K Park T Kim E J Um S J 2011 Additional sex comb like ASXL proteins 1 and 2 play opposite roles in adipogenesis via reciprocal regulation of peroxisome proliferator activated receptor gamma J Biol Chem 286 1354 1363 PMID 21047783 DOI 10 1074 jbc M110 177816PrimitkiZahvoryuvannya genetichno pov yazani z PPARG pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z Peroxisome proliferator activated receptor gamma pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 9236 angl Procitovano 30 serpnya 2017 angl Arhiv originalu za 8 serpnya 2017 Procitovano 30 serpnya 2017 Div takozhHromosoma 3 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi