Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

NF2 англ Neurofibromin 2 білок який кодується однойменним геном розташованим у людей на короткому плечі 22 ї хромосоми Д

NF2

NF2

NF2 (англ. Neurofibromin 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми. Довжина поліпептидного ланцюга білка становить 595 амінокислот, а молекулярна маса — 69 690.

NF2
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NF2, ACN, BANF, SCH, neurofibromin 2 (merlin), neurofibromin 2, merlin-1, moesin-ezrin-radixin like (MERLIN) tumor suppressor
Зовнішні ІД OMIM: 607379 MGI: 97307 HomoloGene: 2180 GeneCards: NF2
Пов'язані генетичні захворювання
benign neurilemmoma
Шаблон експресії
image

image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
4771
18016
Ensembl
ENSG00000186575
ENSMUSG00000009073
UniProt
P35240
P46662
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 22: 29.6 – 29.7 Mb Хр. 11: 4.72 – 4.8 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLV
CRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKF
YPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKY
GDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRAR
DEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRL
TPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC
IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAE
RTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQ
KAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKE
ADQLKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNL
IGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALK
LKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, ядрі, мембрані, клітинних відростках.

Взаємодії

Доведено, що NF2 взаємодіє з:

Література

  • Schmucker B., Tang Y., Kressel M. (1999). Novel alternatively spliced isoforms of the neurofibromatosis type 2 tumor suppressor are targeted to the nucleus and cytoplasmic granules. Hum. Mol. Genet. 8: 1561—1570. PMID 10401006 DOI:10.1093/hmg/8.8.1561
  • Chang L.-S., Akhmametyeva E.M., Wu Y., Zhu L., Welling D.B. (2002). Multiple transcription initiation sites, alternative splicing, and differential polyadenylation contribute to the complexity of human neurofibromatosis 2 transcripts. Genomics. 79: 63—76. PMID 11827459 DOI:10.1006/geno.2001.6672
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Rong R., Tang X., Gutmann D.H., Ye K. (2004). Neurofibromatosis 2 (NF2) tumor suppressor merlin inhibits phosphatidylinositol 3-kinase through binding to PIKE-L. Proc. Natl. Acad. Sci. U.S.A. 101: 18200—18205. PMID 15598747 DOI:10.1073/pnas.0405971102
  • Huang J., Chen J. (2008). VprBP targets Merlin to the Roc1-Cul4A-DDB1 E3 ligase complex for degradation. Oncogene. 27: 4056—4064. PMID 18332868 DOI:10.1038/onc.2008.44
  • Genevet A., Wehr M.C., Brain R., Thompson B.J., Tapon N. (2010). Kibra Is a regulator of the Salvador/Warts/Hippo signaling network. Dev. Cell. 18: 300—308. PMID 20159599 DOI:10.1016/j.devcel.2009.12.011

Примітки

  1. Захворювання, генетично пов'язані з NF2 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:7773 (англ.) . Процитовано 12 вересня 2017.
  5. (англ.) . Архів оригіналу за 4 жовтня 2017. Процитовано 12 вересня 2017.
  6. Huang J, Chen J (July 2008). VprBP targets Merlin to the Roc1-Cul4A-DDB1 E3 ligase complex for degradation. Oncogene. 27 (29): 4056—64. doi:10.1038/onc.2008.44. PMID 18332868.
  7. Grönholm M, Sainio M, Zhao F, Heiska L, Vaheri A, Carpén O (March 1999). Homotypic and heterotypic interaction of the neurofibromatosis 2 tumor suppressor protein merlin and the ERM protein ezrin. J. Cell Sci. 112 (6): 895—904. PMID 10036239.
  8. Gutmann DH, Haipek CA, Burke SP, Sun CX, Scoles DR, Pulst SM (April 2001). The NF2 interactor, hepatocyte growth factor-regulated tyrosine kinase substrate (HRS), associates with merlin in the "open" conformation and suppresses cell growth and motility. Hum. Mol. Genet. 10 (8): 825—34. doi:10.1093/hmg/10.8.825. PMID 11285248.
  9. Scoles DR, Huynh DP, Chen MS, Burke SP, Gutmann DH, Pulst SM (July 2000). The neurofibromatosis 2 tumor suppressor protein interacts with hepatocyte growth factor-regulated tyrosine kinase substrate. Hum. Mol. Genet. 9 (11): 1567—74. doi:10.1093/hmg/9.11.1567. PMID 10861283.
  10. Wiederhold T, Lee MF, James M, Neujahr R, Smith N, Murthy A, Hartwig J, Gusella JF, Ramesh V (November 2004). Magicin, a novel cytoskeletal protein associates with the NF2 tumor suppressor merlin and Grb2. Oncogene. 23 (54): 8815—25. doi:10.1038/sj.onc.1208110. PMID 15467741.
  11. Jannatipour M, Dion P, Khan S, Jindal H, Fan X, Laganière J, Chishti AH, Rouleau GA (August 2001). Schwannomin isoform-1 interacts with syntenin via PDZ domains. J. Biol. Chem. 276 (35): 33093—100. doi:10.1074/jbc.M105792200. PMID 11432873.{{}}: Обслуговування CS1: Сторінки із непозначеним DOI з безкоштовним доступом ()
  12. Neill GW, Crompton MR (September 2001). Binding of the merlin-I product of the neurofibromatosis type 2 tumour suppressor gene to a novel site in beta-fodrin is regulated by association between merlin domains. Biochem. J. 358 (Pt 3): 727—35. doi:10.1042/0264-6021:3580727. PMC 1222106. PMID 11535133.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

NF2 angl Neurofibromin 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 22 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 595 aminokislot a molekulyarna masa 69 690 NF2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB4ZRJ 1H4R 3U8Z 4ZRIIdentifikatoriSimvoliNF2 ACN BANF SCH neurofibromin 2 merlin neurofibromin 2 merlin 1 moesin ezrin radixin like MERLIN tumor suppressorZovnishni ID OMIM 607379 MGI 97307 HomoloGene 2180 GeneCards NF2Pov yazani genetichni zahvoryuvannyabenign neurilemmoma Ontologiya genaMolekulyarna funkciya cytoskeletal protein binding GO 0001948 GO 0016582 protein binding actin bindingKlitinna komponenta citoplazma cell body cell projection membrana Filopodiya ruffle Adgezivni kontakti klitinna membrana apical part of cell ruffle membrane early endosome yaderce cortical actin cytoskeleton perinuclear region of cytoplasm neuron projection Borozna rozsheplennya citoskelet klitinne yadro lamellipodium filopodium membrane gialoplazmaBiologichnij proces negative regulation of receptor signaling pathway via JAK STAT regulation of gliogenesis cell cell junction organization regulation of protein stability negative regulation of cell cell adhesion negative regulation of protein kinase activity mesoderm formation ectoderm development negative regulation of DNA replication Schwann cell proliferation regulation of neural precursor cell proliferation regulation of protein localization to nucleus negative regulation of cell matrix adhesion odontogenesis of dentin containing tooth brain development negative regulation of cell migration lens fiber cell differentiation regulation of cell population proliferation positive regulation of cell differentiation negative regulation of MAPK cascade regulation of hippo signaling hippocampus development regulation of stem cell proliferation regulation of neurogenesis actin cytoskeleton organization positive regulation of stress fiber assembly negative regulation of cell population proliferation negative regulation of tyrosine phosphorylation of STAT protein regulation of apoptotic process regulation of cell cycleDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez4771 18016Ensembl ENSG00000186575 ENSMUSG00000009073UniProt P35240 P46662RefSeq mRNK NM 181835 NM 000268 NM 016418 NM 181825 NM 181826NM 181827 NM 181828 NM 181829 NM 181830 NM 181831 NM 181832 NM 181833 NM 181834NM 001252250 NM 001252251 NM 001252252 NM 001252253 NM 010898NM 001361675 NM 001361676 NM 001361677RefSeq bilok NP 000259 NP 057502 NP 861546 NP 861966 NP 861967NP 861968 NP 861969 NP 861970 NP 861971NP 001239179 NP 001239180 NP 001239181 NP 001239182 NP 035028NP 001348604 NP 001348605 NP 001348606Lokus UCSC Hr 22 29 6 29 7 MbHr 11 4 72 4 8 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLV CRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKF YPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKY GDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRAR DEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRL TPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAE RTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQ KAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKE ADQLKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNL IGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALK LKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Lokalizovanij u klitinnij membrani citoplazmi citoskeleti yadri membrani klitinnih vidrostkah VzayemodiyiDovedeno sho NF2 vzayemodiye z CUL4A DDB1 EZR HGS MED28 RIT1 SDCBP SPTBN1LiteraturaSchmucker B Tang Y Kressel M 1999 Novel alternatively spliced isoforms of the neurofibromatosis type 2 tumor suppressor are targeted to the nucleus and cytoplasmic granules Hum Mol Genet 8 1561 1570 PMID 10401006 DOI 10 1093 hmg 8 8 1561 Chang L S Akhmametyeva E M Wu Y Zhu L Welling D B 2002 Multiple transcription initiation sites alternative splicing and differential polyadenylation contribute to the complexity of human neurofibromatosis 2 transcripts Genomics 79 63 76 PMID 11827459 DOI 10 1006 geno 2001 6672 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Rong R Tang X Gutmann D H Ye K 2004 Neurofibromatosis 2 NF2 tumor suppressor merlin inhibits phosphatidylinositol 3 kinase through binding to PIKE L Proc Natl Acad Sci U S A 101 18200 18205 PMID 15598747 DOI 10 1073 pnas 0405971102 Huang J Chen J 2008 VprBP targets Merlin to the Roc1 Cul4A DDB1 E3 ligase complex for degradation Oncogene 27 4056 4064 PMID 18332868 DOI 10 1038 onc 2008 44 Genevet A Wehr M C Brain R Thompson B J Tapon N 2010 Kibra Is a regulator of the Salvador Warts Hippo signaling network Dev Cell 18 300 308 PMID 20159599 DOI 10 1016 j devcel 2009 12 011PrimitkiZahvoryuvannya genetichno pov yazani z NF2 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 7773 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 4 zhovtnya 2017 Procitovano 12 veresnya 2017 Huang J Chen J July 2008 VprBP targets Merlin to the Roc1 Cul4A DDB1 E3 ligase complex for degradation Oncogene 27 29 4056 64 doi 10 1038 onc 2008 44 PMID 18332868 Gronholm M Sainio M Zhao F Heiska L Vaheri A Carpen O March 1999 Homotypic and heterotypic interaction of the neurofibromatosis 2 tumor suppressor protein merlin and the ERM protein ezrin J Cell Sci 112 6 895 904 PMID 10036239 Gutmann DH Haipek CA Burke SP Sun CX Scoles DR Pulst SM April 2001 The NF2 interactor hepatocyte growth factor regulated tyrosine kinase substrate HRS associates with merlin in the open conformation and suppresses cell growth and motility Hum Mol Genet 10 8 825 34 doi 10 1093 hmg 10 8 825 PMID 11285248 Scoles DR Huynh DP Chen MS Burke SP Gutmann DH Pulst SM July 2000 The neurofibromatosis 2 tumor suppressor protein interacts with hepatocyte growth factor regulated tyrosine kinase substrate Hum Mol Genet 9 11 1567 74 doi 10 1093 hmg 9 11 1567 PMID 10861283 Wiederhold T Lee MF James M Neujahr R Smith N Murthy A Hartwig J Gusella JF Ramesh V November 2004 Magicin a novel cytoskeletal protein associates with the NF2 tumor suppressor merlin and Grb2 Oncogene 23 54 8815 25 doi 10 1038 sj onc 1208110 PMID 15467741 Jannatipour M Dion P Khan S Jindal H Fan X Laganiere J Chishti AH Rouleau GA August 2001 Schwannomin isoform 1 interacts with syntenin via PDZ domains J Biol Chem 276 35 33093 100 doi 10 1074 jbc M105792200 PMID 11432873 a href wiki D0 A8 D0 B0 D0 B1 D0 BB D0 BE D0 BD Cite journal title Shablon Cite journal cite journal a Obslugovuvannya CS1 Storinki iz nepoznachenim DOI z bezkoshtovnim dostupom posilannya Neill GW Crompton MR September 2001 Binding of the merlin I product of the neurofibromatosis type 2 tumour suppressor gene to a novel site in beta fodrin is regulated by association between merlin domains Biochem J 358 Pt 3 727 35 doi 10 1042 0264 6021 3580727 PMC 1222106 PMID 11535133 Div takozhHromosoma 22 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ