Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

EZR англ Ezrin білок який кодується однойменним геном розташованим у людей на короткому плечі 6 ї хромосоми Довжина полі

EZR

EZR

EZR (англ. Ezrin) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми. Довжина поліпептидного ланцюга білка становить 586 амінокислот, а молекулярна маса — 69 413.

EZR
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи EZR, CVIL, CVL, HEL-S-105, VIL2, Ezrin
Зовнішні ІД OMIM: 123900 MGI: 98931 HomoloGene: 55740 GeneCards: EZR
Шаблон експресії
image

image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
7430
22350
Ensembl
ENSG00000092820
ENSMUSG00000052397
UniProt
P15311
P26040
RefSeq (мРНК)
NM_001111077
NM_003379
NM_009510
RefSeq (білок)
NP_001104547
NP_003370
NP_033536
Локус (UCSC) Хр. 6: 158.77 – 158.82 Mb Хр. 17: 7.01 – 7.05 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYV
DNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQK
LFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSE
RLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEM
YGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISF
NDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLR
LQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAK
EELERQAVDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAK
EAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQDEGAEPTGYS
AELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHN
DIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL

Задіяний у такому біологічному процесі як пдтримання форми клітини. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані, клітинних відростках.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Egerton M., Moritz R.L., Druker B., Kelso A., Simpson R.J. (1996). Identification of the 70kD heat shock cognate protein (Hsc70) and alpha-actinin-1 as novel phosphotyrosine-containing proteins in T lymphocytes. Biochem. Biophys. Res. Commun. 224: 666—674. PMID 8713105 DOI:10.1006/bbrc.1996.1082
  • Reczek D., Berryman M., Bretscher A. (1997). Identification of EBP50: a PDZ-containing phosphoprotein that associates with members of the ezrin-radixin-moesin family. J. Cell Biol. 139: 169—179. PMID 9314537 DOI:10.1083/jcb.139.1.169
  • Sullivan A., Uff C.R., Isacke C.M., Thorne R.F. (2003). PACE-1, a novel protein that interacts with the C-terminal domain of ezrin. Exp. Cell Res. 284: 224—238. PMID 12651155 DOI:10.1016/S0014-4827(02)00054-X
  • Koltzscher M., Neumann C., Konig S., Gerke V. (2003). Ca2+-dependent binding and activation of dormant ezrin by dimeric S100P. Mol. Biol. Cell. 14: 2372—2384. PMID 12808036 DOI:10.1091/mbc.E02-09-0553
  • Sizemore S., Cicek M., Sizemore N., Ng K.P., Casey G. (2007). Podocalyxin increases the aggressive phenotype of breast and prostate cancer cells in vitro through its interaction with ezrin. Cancer Res. 67: 6183—6191. PMID 17616675 DOI:10.1158/0008-5472.CAN-06-3575

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. (англ.) . Архів оригіналу за 26 березня 2016. Процитовано 21 серпня 2017.
  4. (англ.) . Архів оригіналу за 11 вересня 2017. Процитовано 21 серпня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

EZR angl Ezrin bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 6 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 586 aminokislot a molekulyarna masa 69 413 EZRNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB4RM8 4RMA 4RM9 1NI2IdentifikatoriSimvoliEZR CVIL CVL HEL S 105 VIL2 EzrinZovnishni ID OMIM 123900 MGI 98931 HomoloGene 55740 GeneCards EZROntologiya genaMolekulyarna funkciya protein domain specific binding GO 0032403 protein containing complex binding cytoskeletal protein binding protein kinase A regulatory subunit binding protein kinase A catalytic subunit binding S100 protein binding actin filament binding GO 0001948 GO 0016582 protein binding cell adhesion molecule binding microtubule binding ATPase binding actin binding RNA binding cadherin binding protein C terminus binding disordered domain specific binding protein kinase A binding identical protein bindingKlitinna komponenta citoplazma gialoplazma endosoma membrana focal adhesion T tubule ruffle Schwann cell microvillus ruffle membrane actin cytoskeleton perinuclear region of cytoplasm citoskelet cell projection cytoplasmic side of apical plasma membrane myelin sheath Mikrovorsinki microspike apical plasma membrane membrane raft ekzosoma microvillus membrane ciliary basal body Filopodiya cortical cytoskeleton klitinna membrana apical part of cell astrocyte projection vnutrishnoklitinnij cell cortex brush border mikrofilament TCR signalosome cell periphery cell body vezikula plasma membrane raft uropod basolateral plasma membrane immunological synapse cell tip fibrillar center mizhklitinnij prostir extrinsic component of membrane GO 0009327 protein containing complexBiologichnij proces leukocyte cell cell adhesion regulation of organelle assembly sphingosine 1 phosphate receptor signaling pathway negative regulation of p38MAPK cascade actin filament bundle assembly establishment of epithelial cell apical basal polarity positive regulation of multicellular organism growth astral microtubule organization cellular response to cAMP establishment of endothelial barrier microvillus assembly negative regulation of T cell receptor signaling pathway gland morphogenesis cortical microtubule organization positive regulation of protein localization to early endosome positive regulation of early endosome to late endosome transport intestinal D glucose absorption establishment or maintenance of apical basal cell polarity regulation of NIK NF kappaB signaling epithelial cell differentiation regulation of actin cytoskeleton organization GO 1901227 negative regulation of transcription by RNA polymerase II positive regulation of protein secretion membrane to membrane docking regulation of cell shape protein kinase A signaling establishment of centrosome localization phosphatidylinositol mediated signaling regulation of cell size actin cytoskeleton reorganization filopodium assembly receptor internalization terminal web assembly axon guidance GO 1901313 positive regulation of gene expression negative regulation of ERK1 and ERK2 cascade protein localization to cell cortex regulation of microvillus length protein localization to plasma membrane positive regulation of protein localization to plasma membraneDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez7430 22350Ensembl ENSG00000092820 ENSMUSG00000052397UniProt P15311 P26040RefSeq mRNK NM 001111077 NM 003379NM 009510RefSeq bilok NP 001104547 NP 003370NP 033536Lokus UCSC Hr 6 158 77 158 82 MbHr 17 7 01 7 05 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYV DNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQK LFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSE RLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEM YGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISF NDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLR LQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAK EELERQAVDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAK EAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQDEGAEPTGYS AELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHN DIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takomu biologichnomu procesi yak pdtrimannya formi klitini Lokalizovanij u klitinnij membrani citoplazmi citoskeleti membrani klitinnih vidrostkah LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Egerton M Moritz R L Druker B Kelso A Simpson R J 1996 Identification of the 70kD heat shock cognate protein Hsc70 and alpha actinin 1 as novel phosphotyrosine containing proteins in T lymphocytes Biochem Biophys Res Commun 224 666 674 PMID 8713105 DOI 10 1006 bbrc 1996 1082 Reczek D Berryman M Bretscher A 1997 Identification of EBP50 a PDZ containing phosphoprotein that associates with members of the ezrin radixin moesin family J Cell Biol 139 169 179 PMID 9314537 DOI 10 1083 jcb 139 1 169 Sullivan A Uff C R Isacke C M Thorne R F 2003 PACE 1 a novel protein that interacts with the C terminal domain of ezrin Exp Cell Res 284 224 238 PMID 12651155 DOI 10 1016 S0014 4827 02 00054 X Koltzscher M Neumann C Konig S Gerke V 2003 Ca2 dependent binding and activation of dormant ezrin by dimeric S100P Mol Biol Cell 14 2372 2384 PMID 12808036 DOI 10 1091 mbc E02 09 0553 Sizemore S Cicek M Sizemore N Ng K P Casey G 2007 Podocalyxin increases the aggressive phenotype of breast and prostate cancer cells in vitro through its interaction with ezrin Cancer Res 67 6183 6191 PMID 17616675 DOI 10 1158 0008 5472 CAN 06 3575PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 26 bereznya 2016 Procitovano 21 serpnya 2017 angl Arhiv originalu za 11 veresnya 2017 Procitovano 21 serpnya 2017 Div takozhHromosoma 6 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ