Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
HTR1B (англ. 5-hydroxytryptamine receptor 1B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми. Довжина поліпептидного ланцюга білка становить 390 амінокислот, а молекулярна маса — 43 568.
| HTR1B | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
 | |||||||||||||||||
| |||||||||||||||||
| Ідентифікатори | |||||||||||||||||
| Символи | HTR1B, 5-HT1B, 5-HT1DB, HTR1D2, HTR1DB, S12, 5-HT-1B, 5-HT-1D-beta, 5-hydroxytryptamine receptor 1B | ||||||||||||||||
| Зовнішні ІД | OMIM: 182131 MGI: 96274 HomoloGene: 669 GeneCards: HTR1B | ||||||||||||||||
| Реагує на сполуку | |||||||||||||||||
| frovatriptan, 1-naphthylpiperazine, 2-methyl-5-HT, 5-carboxamidotryptamine, Серотонін, 5-methoxytryptamine, 5-(nonyloxy)-tryptamine, (+/-)-8-hydroxy-2-(di-N-propylamino)tetralin, alniditan, арипіпразол, каберголін, CGS-12066A, клозапін, CP-122288, CP94253, дігідроертотамін, donitriptan, елетріптан, lysergol, оланзапін, оксиметазолін, pergolide, ru-24969, 1-(3-trifluoromethylphenyl)piperazine, триптамін, xanomeline, зипразидон, brl-15572, бромокриптин, gr-127935, lisuride, наратріптан, різатріптан, roxindole, sb-216641, суматріптан, terguride, вортіоксетин, золмітріптан, ketanserin, metergoline, methysergide, ocaperidone, pipamperone, α-yohimbine, рисперидон, ritanserin, сертиндол, yohimbine, zotepine, metitepine, SB236057, sumatriptan succinate, donitriptan, Зімелідин, різатріптан, золмітріптан, naratriptan hydrochloride | |||||||||||||||||
| |||||||||||||||||
| Шаблон експресії | |||||||||||||||||
 | |||||||||||||||||
| Більше даних | |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 6: 77.46 – 77.46 Mb | Хр. 9: 81.51 – 81.52 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MEEPGAQCAP | PPPAGSETWV | PQANLSSAPS | QNCSAKDYIY | QDSISLPWKV | ||||
| LLVMLLALIT | LATTLSNAFV | IATVYRTRKL | HTPANYLIAS | LAVTDLLVSI | ||||
| LVMPISTMYT | VTGRWTLGQV | VCDFWLSSDI | TCCTASILHL | CVIALDRYWA | ||||
| ITDAVEYSAK | RTPKRAAVMI | ALVWVFSISI | SLPPFFWRQA | KAEEEVSECV | ||||
| VNTDHILYTV | YSTVGAFYFP | TLLLIALYGR | IYVEARSRIL | KQTPNRTGKR | ||||
| LTRAQLITDS | PGSTSSVTSI | NSRVPDVPSE | SGSPVYVNQV | KVRVSDALLE | ||||
| KKKLMAARER | KATKTLGIIL | GAFIVCWLPF | FIISLVMPIC | KDACWFHLAI | ||||
| FDFFTWLGYL | NSLINPIIYT | MSNEDFKQAF | HKLIRFKCTS |
Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, , фосфопротеїнів. Локалізований у клітинній мембрані, мембрані.
Література
- Hamblin M.W., Metcalf M.A., McGuffin R.W., Karpells S. (1992). Molecular cloning and functional characterization of a human 5-HT1B serotonin receptor: a homologue of the rat 5-HT1B receptor with 5-HT1D-like pharmacological specificity. Biochem. Biophys. Res. Commun. 184: 752—759. PMID 1315531 DOI:10.1016/0006-291X(92)90654-4
- Mochizuki D., Yuyama Y., Tsujita R., Komaki H., Sagai H. (1992). Cloning and expression of the human 5-HT1B-type receptor gene. Biochem. Biophys. Res. Commun. 185: 517—523. PMID 1610347 DOI:10.1016/0006-291X(92)91655-A
- Weinshank R.L., Zgombick J.M., Macchi M.J., Branchek T.A., Hartig P.R. (1992). Human serotonin 1D receptor is encoded by a subfamily of two distinct genes: 5-HT1D alpha and 5-HT1D beta. Proc. Natl. Acad. Sci. U.S.A. 89: 3630—3634. PMID 1565658 DOI:10.1073/pnas.89.8.3630
- Kitano T., Liu Y.-H., Ueda S., Saitou N. (2004). Human-specific amino acid changes found in 103 protein-coding genes. Mol. Biol. Evol. 21: 936—944. PMID 15014171 DOI:10.1093/molbev/msh100
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Xie Z., Lee S.P., O'Dowd B.F., George S.R. (1999). Serotonin 5-HT1B and 5-HT1D receptors form homodimers when expressed alone and heterodimers when co-expressed. FEBS Lett. 456: 63—67. PMID 10452531 DOI:10.1016/S0014-5793(99)00918-7
Примітки
- Сполуки, які фізично взаємодіють з HTR1B переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:5287 (англ.) . Архів оригіналу за 19 жовтня 2016. Процитовано 6 вересня 2017.
- UniProt, P28222 (англ.) . Архів оригіналу за 25 серпня 2017. Процитовано 6 вересня 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
HTR1B angl 5 hydroxytryptamine receptor 1B bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 6 yi hromosomi 4 Dovzhina polipeptidnogo lancyuga bilka stanovit 390 aminokislot a molekulyarna masa 43 568 5 HTR1BNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB4IAQ 4IARIdentifikatoriSimvoliHTR1B 5 HT1B 5 HT1DB HTR1D2 HTR1DB S12 5 HT 1B 5 HT 1D beta 5 hydroxytryptamine receptor 1BZovnishni ID OMIM 182131 MGI 96274 HomoloGene 669 GeneCards HTR1BReaguye na spolukufrovatriptan 1 naphthylpiperazine 2 methyl 5 HT 5 carboxamidotryptamine Serotonin 5 methoxytryptamine 5 nonyloxy tryptamine 8 hydroxy 2 di N propylamino tetralin alniditan aripiprazol kabergolin CGS 12066A klozapin CP 122288 CP94253 digidroertotamin donitriptan eletriptan lysergol olanzapin oksimetazolin pergolide ru 24969 1 3 trifluoromethylphenyl piperazine triptamin xanomeline ziprazidon brl 15572 bromokriptin gr 127935 lisuride naratriptan rizatriptan roxindole sb 216641 sumatriptan terguride vortioksetin zolmitriptan ketanserin metergoline methysergide ocaperidone pipamperone a yohimbine risperidon ritanserin sertindol yohimbine zotepine metitepine SB236057 sumatriptan succinate donitriptan Zimelidin rizatriptan zolmitriptan naratriptan hydrochloride 1 Ontologiya genaMolekulyarna funkciya G protein coupled receptor activity signal transducer activity G protein coupled serotonin receptor activity GO 0001948 GO 0016582 protein binding neurotransmitter receptor activity serotonin binding voltage gated calcium channel activity involved in regulation of presynaptic cytosolic calcium levelsKlitinna komponenta citoplazma integral component of membrane membrana integral component of plasma membrane klitinna membrana calyx of Held integral component of presynaptic membrane serotonergic synapse dendrit nejrobiologiya Biologichnij proces chemical synaptic transmission G protein coupled receptor internalization regulation of dopamine secretion regulation of behavior response to mineralocorticoid vazokonstrikciya adenylate cyclase inhibiting serotonin receptor signaling pathway G protein coupled receptor signaling pathway coupled to cyclic nucleotide second messenger cellular response to alkaloid negative regulation of serotonin secretion cellular response to temperature stimulus negative regulation of synaptic transmission GABAergic protein kinase C activating G protein coupled receptor signaling pathway drinking behavior bone remodeling harchova povedinka response to ethanol negative regulation of synaptic transmission glutamatergic GO 0072468 signalna transdukciya response to cocaine positive regulation of vascular associated smooth muscle cell proliferation G protein coupled receptor signaling pathway adenylate cyclase inhibiting G protein coupled receptor signaling pathway GO 0035737 povedinka tvarin presynaptic modulation of chemical synaptic transmission regulation of synaptic vesicle exocytosis regulation of presynaptic cytosolic calcium ion concentrationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3351 15551Ensembl ENSG00000135312 ENSMUSG00000049511UniProt P28222 P28334RefSeq mRNK NM 000863NM 010482RefSeq bilok NP 000854NP 034612Lokus UCSC Hr 6 77 46 77 46 MbHr 9 81 51 81 52 MbPubMed search 2 3 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKV LLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSI LVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASILHLCVIALDRYWA ITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECV VNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILKQTPNRTGKR LTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAI FDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLIRFKCTS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv g bilokspryazhenih receptoriv bilkiv vnutrishnoklitinnogo signalingu fosfoproteyiniv Lokalizovanij u klitinnij membrani membrani Literaturared Hamblin M W Metcalf M A McGuffin R W Karpells S 1992 Molecular cloning and functional characterization of a human 5 HT1B serotonin receptor a homologue of the rat 5 HT1B receptor with 5 HT1D like pharmacological specificity Biochem Biophys Res Commun 184 752 759 PMID 1315531 DOI 10 1016 0006 291X 92 90654 4 Mochizuki D Yuyama Y Tsujita R Komaki H Sagai H 1992 Cloning and expression of the human 5 HT1B type receptor gene Biochem Biophys Res Commun 185 517 523 PMID 1610347 DOI 10 1016 0006 291X 92 91655 A Weinshank R L Zgombick J M Macchi M J Branchek T A Hartig P R 1992 Human serotonin 1D receptor is encoded by a subfamily of two distinct genes 5 HT1D alpha and 5 HT1D beta Proc Natl Acad Sci U S A 89 3630 3634 PMID 1565658 DOI 10 1073 pnas 89 8 3630 Kitano T Liu Y H Ueda S Saitou N 2004 Human specific amino acid changes found in 103 protein coding genes Mol Biol Evol 21 936 944 PMID 15014171 DOI 10 1093 molbev msh100 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Xie Z Lee S P O Dowd B F George S R 1999 Serotonin 5 HT1B and 5 HT1D receptors form homodimers when expressed alone and heterodimers when co expressed FEBS Lett 456 63 67 PMID 10452531 DOI 10 1016 S0014 5793 99 00918 7Primitkired Spoluki yaki fizichno vzayemodiyut z HTR1B pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 5287 angl Arhiv originalu za 19 zhovtnya 2016 Procitovano 6 veresnya 2017 UniProt P28222 angl Arhiv originalu za 25 serpnya 2017 Procitovano 6 veresnya 2017 Div takozhred Hromosoma 6 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title HTR1B amp oldid 35465277