CCNB1 (англ. Cyclin B1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. Довжина поліпептидного ланцюга білка становить 433 амінокислот, а молекулярна маса — 48 337.
CCNB1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CCNB1, CCNB, cyclin B1 | ||||||||||||||||
Зовнішні ІД | OMIM: 123836 MGI: 3648694 HomoloGene: 68982 GeneCards: CCNB1 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 5: 69.17 – 69.18 Mb | Хр. 7: 41.76 – 41.76 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MALRVTRNSK | INAENKAKIN | MAGAKRVPTA | PAATSKPGLR | PRTALGDIGN | ||||
KVSEQLQAKM | PMKKEAKPSA | TGKVIDKKLP | KPLEKVPMLV | PVPVSEPVPE | ||||
PEPEPEPEPV | KEEKLSPEPI | LVDTASPSPM | ETSGCAPAEE | DLCQAFSDVI | ||||
LAVNDVDAED | GADPNLCSEY | VKDIYAYLRQ | LEEEQAVRPK | YLLGREVTGN | ||||
MRAILIDWLV | QVQMKFRLLQ | ETMYMTVSII | DRFMQNNCVP | KKMLQLVGVT | ||||
AMFIASKYEE | MYPPEIGDFA | FVTDNTYTKH | QIRQMEMKIL | RALNFGLGRP | ||||
LPLHFLRRAS | KIGEVDVEQH | TLAKYLMELT | MLDYDMVHFP | PSQIAAGAFC | ||||
LALKILDNGE | WTPTLQHYLS | YTEESLLPVM | QHLAKNVVMV | NQGLTKHMTV | ||||
KNKYATSKHA | KISTLPQLNS | ALVQDLAKAV | AKV |
Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як клітинний цикл, поділ клітини, мітоз, ацетилювання, альтернативний сплайсинг. Локалізований у цитоплазмі, цитоскелеті, ядрі.
Література
- Pines J., Hunter T. (1989). Isolation of a human cyclin cDNA: evidence for cyclin mRNA and protein regulation in the cell cycle and for interaction with p34cdc2. Cell. 58: 833—846. PMID 2570636 DOI:10.1016/0092-8674(89)90936-7
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Kong M., Barnes E.A., Ollendorff V., Donoghue D.J. (2000). Cyclin F regulates the nuclear localization of cyclin B1 through a cyclin-cyclin interaction. EMBO J. 19: 1378—1388. PMID 10716937 DOI:10.1093/emboj/19.6.1378
- Rosse C., L'Hoste S., Offner N., Picard A., Camonis J. (2003). RLIP, an effector of the Ral GTPases, is a platform for Cdk1 to phosphorylate epsin during the switch off of endocytosis in mitosis. J. Biol. Chem. 278: 30597—30604. PMID 12775724 DOI:10.1074/jbc.M302191200
- Toby G.G., Gherraby W., Coleman T.R., Golemis E.A. (2003). A novel RING finger protein, human enhancer of invasion 10, alters mitotic progression through regulation of cyclin B levels. Mol. Cell. Biol. 23: 2109—2122. PMID 12612082 DOI:10.1128/MCB.23.6.2109-2122.2003
- Jackman M., Lindon C., Nigg E.A., Pines J. (2003). Active cyclin B1-Cdk1 first appears on centrosomes in prophase. Nat. Cell Biol. 5: 143—148. PMID 12524548 DOI:10.1038/ncb918
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:1579 (англ.) . Процитовано 31 серпня 2017.
{{}}
: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url () - UniProt, P14635 (англ.) . Процитовано 31 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CCNB1 angl Cyclin B1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 5 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 433 aminokislot a molekulyarna masa 48 337 4 CCNB1Nayavni strukturiPDBPoshuk dlya lyudej PDBe RCSB Spisok kodiv PDB2B9R 2JGZ 4Y72 5HQ0 4YC3IdentifikatoriSimvoliCCNB1 CCNB cyclin B1Zovnishni ID OMIM 123836 MGI 3648694 HomoloGene 68982 GeneCards CCNB1Ontologiya genaMolekulyarna funkciya histone kinase activity kinase activity patched binding GO 0001948 GO 0016582 protein binding cyclin dependent protein serine threonine kinase activity GO 0016534 cyclin dependent protein serine threonine kinase activator activity ubiquitin like protein ligase binding protein kinase binding protein kinase activity cyclin dependent protein serine threonine kinase regulator activityKlitinna komponenta citoplazma centrosoma spindle pole membrana nukleoplazma centr organizaciyi mikrotrubochok citoskelet klitinne yadro gialoplazma mitohondrialnij matriks cyclin B1 CDK1 complex cyclin dependent protein kinase holoenzyme complexBiologichnij proces GO 0033128 negative regulation of protein phosphorylation response to DDT regulation of mitotic cell cycle spindle assembly checkpoint positive regulation of mRNA 3 end processing tissue regeneration positive regulation of fibroblast proliferation cellular response to iron III ion GO 1904579 cellular response to organic cyclic compound response to mechanical stimulus positive regulation of mitotic cell cycle in utero embryonic development negative regulation of gene expression regulation of cell cycle podil klitini positive regulation of attachment of spindle microtubules to kinetochore protein phosphorylation mitotic nuclear membrane disassembly cellular response to fatty acid positive regulation of cardiac muscle cell proliferation positive regulation of cell cycle G2 M transition of mitotic cell cycle oocyte maturation Spermatogenez klitinnij cikl mitotic metaphase plate congression anaphase promoting complex dependent catabolic process regulation of chromosome condensation digestive tract development ventricular cardiac muscle cell development cellular response to hypoxia response to toxic substance GO 0043148 mitotic spindle organization GO 0007067 mitoz DNA damage response signal transduction by p53 class mediator resulting in cell cycle arrest positive regulation of mitochondrial ATP synthesis coupled electron transport positive regulation of G2 M transition of mitotic cell cycle positive regulation of cyclin dependent protein serine threonine kinase activity GO 0034622 protein containing complex assembly regulation of cyclin dependent protein serine threonine kinase activity regulation of mitotic nuclear division positive regulation of cell population proliferation transcription initiation from RNA polymerase II promoter regulation of mitotic cell cycle phase transitionDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez891 434175Ensembl ENSG00000134057 ENSMUSG00000048574UniProt P14635 n dRefSeq mRNK NM 031966 NM 001354844 NM 001354845XM 036153675RefSeq bilok NP 114172 NP 001341773 NP 001341774n dLokus UCSC Hr 5 69 17 69 18 MbHr 7 41 76 41 76 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGN KVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPE PEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVI LAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGN MRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVT AMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFC LALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTV KNKYATSKHAKISTLPQLNSALVQDLAKAVAKV A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak klitinnij cikl podil klitini mitoz acetilyuvannya alternativnij splajsing Lokalizovanij u citoplazmi citoskeleti yadri Literaturared Pines J Hunter T 1989 Isolation of a human cyclin cDNA evidence for cyclin mRNA and protein regulation in the cell cycle and for interaction with p34cdc2 Cell 58 833 846 PMID 2570636 DOI 10 1016 0092 8674 89 90936 7 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Kong M Barnes E A Ollendorff V Donoghue D J 2000 Cyclin F regulates the nuclear localization of cyclin B1 through a cyclin cyclin interaction EMBO J 19 1378 1388 PMID 10716937 DOI 10 1093 emboj 19 6 1378 Rosse C L Hoste S Offner N Picard A Camonis J 2003 RLIP an effector of the Ral GTPases is a platform for Cdk1 to phosphorylate epsin during the switch off of endocytosis in mitosis J Biol Chem 278 30597 30604 PMID 12775724 DOI 10 1074 jbc M302191200 Toby G G Gherraby W Coleman T R Golemis E A 2003 A novel RING finger protein human enhancer of invasion 10 alters mitotic progression through regulation of cyclin B levels Mol Cell Biol 23 2109 2122 PMID 12612082 DOI 10 1128 MCB 23 6 2109 2122 2003 Jackman M Lindon C Nigg E A Pines J 2003 Active cyclin B1 Cdk1 first appears on centrosomes in prophase Nat Cell Biol 5 143 148 PMID 12524548 DOI 10 1038 ncb918Primitkired Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1579 angl Procitovano 31 serpnya 2017 a href wiki D0 A8 D0 B0 D0 B1 D0 BB D0 BE D0 BD Cite web title Shablon Cite web cite web a Obslugovuvannya CS1 Storinki z parametrom url status ale bez parametra archive url posilannya UniProt P14635 angl Procitovano 31 serpnya 2017 Div takozhred Hromosoma 5 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title Ciklin B1 amp oldid 43378125