Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

CASP2 англ Caspase 2 білок який кодується однойменним геном розташованим у людей на короткому плечі 7 ї хромосоми Довжин

Каспаза-2

Каспаза-2

CASP2 (англ. Caspase 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми. Довжина поліпептидного ланцюга білка становить 452 амінокислот, а молекулярна маса — 50 685.

CASP2
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CASP2, CASP-2, ICH1, NEDD-2, NEDD2, PPP1R57, caspase 2
Зовнішні ІД OMIM: 600639 MGI: 97295 HomoloGene: 7254 GeneCards: CASP2
Реагує на сполуку
emricasan
Шаблон експресії
image

image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
835
12366
Ensembl
ENSG00000106144
ENSMUSG00000029863
UniProt
P42575
P29594
RefSeq (мРНК)
NM_032983
NM_001224
NM_032982
NM_032984
NM_007610
RefSeq (білок)
NP_001215
NP_116764
NP_116765
NP_031636
Локус (UCSC) Хр. 7: 143.29 – 143.31 Mb Хр. 6: 42.24 – 42.26 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQ
LLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFD
AFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPL
YKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRG
LALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQE
MQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLF
DNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGK
EKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACD
MHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHP
PT

Кодований геном білок за функціями належить до гідролаз, протеаз, тіолових протеаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, ацетилювання, альтернативний сплайсинг.

Література

  • Wang L., Miura M., Bergeron L., Zhu H., Yuan J. (1994). Ich-1, an Ice/ced-3-related gene, encodes both positive and negative regulators of programmed cell death. Cell. 78: 739—750. PMID 8087842 DOI:10.1016/S0092-8674(94)90422-7
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Xue D., Shaham S., Horvitz H.R. (1996). The Caenorhabditis elegans cell-death protein CED-3 is a cysteine protease with substrate specificities similar to those of the human CPP32 protease. Genes Dev. 10: 1073—1083. PMID 8654923 DOI:10.1101/gad.10.9.1073
  • Koseki T., Inohara N., Chen S., Nunez G. (1998). ARC, an inhibitor of apoptosis expressed in skeletal muscle and heart that interacts selectively with caspases. Proc. Natl. Acad. Sci. U.S.A. 95: 5156—5160. PMID 9560245 DOI:10.1073/pnas.95.9.5156
  • Tinel A., Tschopp J. (2004). The PIDDosome, a protein complex implicated in activation of caspase-2 in response to genotoxic stress. Science. 304: 843—846. PMID 15073321 DOI:10.1126/science.1095432
  • Vakifahmetoglu H., Olsson M., Orrenius S., Zhivotovsky B. (2006). Functional connection between p53 and caspase-2 is essential for apoptosis induced by DNA damage. Oncogene. 25: 5683—5692. PMID 16652156 DOI:10.1038/sj.onc.1209569

Примітки

  1. Сполуки, які фізично взаємодіють з Caspase 2 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. (англ.) . Архів оригіналу за 22 вересня 2017. Процитовано 7 вересня 2017.
  5. (англ.) . Архів оригіналу за 21 вересня 2017. Процитовано 7 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

CASP2 angl Caspase 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 7 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 452 aminokislot a molekulyarna masa 50 685 CASP2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1PYO 2P2C 3R5J 3R6G 3R6L 3R7B 3R7N 3R7S 3RJMIdentifikatoriSimvoliCASP2 CASP 2 ICH1 NEDD 2 NEDD2 PPP1R57 caspase 2Zovnishni ID OMIM 600639 MGI 97295 HomoloGene 7254 GeneCards CASP2Reaguye na spolukuemricasan Ontologiya genaMolekulyarna funkciya cysteine type peptidase activity protein domain specific binding GO 0070122 peptidase activity GO 0001948 GO 0016582 protein binding enzyme binding hydrolase activity identical protein binding cysteine type endopeptidase activity involved in apoptotic process cysteine type endopeptidase activity cysteine type endopeptidase activity involved in execution phase of apoptosisKlitinna komponenta citoplazma gialoplazma membrana mitohondriya klitinne yadroBiologichnij proces DNA damage response signal transduction by p53 class mediator resulting in cell cycle arrest execution phase of apoptosis protein processing GO 0010260 starinnya lyudini positive regulation of apoptotic signaling pathway luteolysis cellular response to mechanical stimulus positive regulation of neuron apoptotic process brain development intrinsic apoptotic signaling pathway in response to DNA damage extrinsic apoptotic signaling pathway in absence of ligand positive regulation of apoptotic process ectopic germ cell programmed cell death apoptotic signaling pathway neural retina development GO 0097285 apoptoz regulation of apoptotic process proteoliz negative regulation of apoptotic processDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez835 12366Ensembl ENSG00000106144 ENSMUSG00000029863UniProt P42575 P29594RefSeq mRNK NM 032983 NM 001224 NM 032982 NM 032984NM 007610RefSeq bilok NP 001215 NP 116764 NP 116765NP 031636Lokus UCSC Hr 7 143 29 143 31 MbHr 6 42 24 42 26 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQ LLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFD AFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPL YKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRG LALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQE MQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLF DNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGK EKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACD MHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHP PT A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do gidrolaz proteaz tiolovih proteaz fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak apoptoz acetilyuvannya alternativnij splajsing LiteraturaWang L Miura M Bergeron L Zhu H Yuan J 1994 Ich 1 an Ice ced 3 related gene encodes both positive and negative regulators of programmed cell death Cell 78 739 750 PMID 8087842 DOI 10 1016 S0092 8674 94 90422 7 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Xue D Shaham S Horvitz H R 1996 The Caenorhabditis elegans cell death protein CED 3 is a cysteine protease with substrate specificities similar to those of the human CPP32 protease Genes Dev 10 1073 1083 PMID 8654923 DOI 10 1101 gad 10 9 1073 Koseki T Inohara N Chen S Nunez G 1998 ARC an inhibitor of apoptosis expressed in skeletal muscle and heart that interacts selectively with caspases Proc Natl Acad Sci U S A 95 5156 5160 PMID 9560245 DOI 10 1073 pnas 95 9 5156 Tinel A Tschopp J 2004 The PIDDosome a protein complex implicated in activation of caspase 2 in response to genotoxic stress Science 304 843 846 PMID 15073321 DOI 10 1126 science 1095432 Vakifahmetoglu H Olsson M Orrenius S Zhivotovsky B 2006 Functional connection between p53 and caspase 2 is essential for apoptosis induced by DNA damage Oncogene 25 5683 5692 PMID 16652156 DOI 10 1038 sj onc 1209569PrimitkiSpoluki yaki fizichno vzayemodiyut z Caspase 2 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 22 veresnya 2017 Procitovano 7 veresnya 2017 angl Arhiv originalu za 21 veresnya 2017 Procitovano 7 veresnya 2017 Div takozhHromosoma 7 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ