PTPN11 (англ. Protein tyrosine phosphatase, non-receptor type 11) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми. Довжина поліпептидного ланцюга білка становить 597 амінокислот, а молекулярна маса — 68 436.
PTPN11 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | PTPN11, BPTP3, CFC, JMML, METCDS, NS1, PTP-1D, PTP2C, SH-PTP2, SH-PTP3, SHP2, protein tyrosine phosphatase, non-receptor type 11, protein tyrosine phosphatase non-receptor type 11 | ||||||||||||||||
Зовнішні ІД | OMIM: 176876 MGI: 99511 HomoloGene: 2122 GeneCards: PTPN11 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
juvenile myelomonocytic leukemia, metachondromatosis | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 12: 112.42 – 112.51 Mb | Хр. 5: 121.27 – 121.33 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MTSRRWFHPN | ITGVEAENLL | LTRGVDGSFL | ARPSKSNPGD | FTLSVRRNGA | ||||
VTHIKIQNTG | DYYDLYGGEK | FATLAELVQY | YMEHHGQLKE | KNGDVIELKY | ||||
PLNCADPTSE | RWFHGHLSGK | EAEKLLTEKG | KHGSFLVRES | QSHPGDFVLS | ||||
VRTGDDKGES | NDGKSKVTHV | MIRCQELKYD | VGGGERFDSL | TDLVEHYKKN | ||||
PMVETLGTVL | QLKQPLNTTR | INAAEIESRV | RELSKLAETT | DKVKQGFWEE | ||||
FETLQQQECK | LLYSRKEGQR | QENKNKNRYK | NILPFDHTRV | VLHDGDPNEP | ||||
VSDYINANII | MPEFETKCNN | SKPKKSYIAT | QGCLQNTVND | FWRMVFQENS | ||||
RVIVMTTKEV | ERGKSKCVKY | WPDEYALKEY | GVMRVRNVKE | SAAHDYTLRE | ||||
LKLSKVGQAL | LQGNTERTVW | QYHFRTWPDH | GVPSDPGGVL | DFLEEVHHKQ | ||||
ESIMDAGPVV | VHCSAGIGRT | GTFIVIDILI | DIIREKGVDC | DIDVPKTIQM | ||||
VRSQRSGMVQ | TEAQYRFIYM | AVQHYIETLQ | RRIEEEQKSK | RKGHEYTNIK | ||||
YSLADQTSGD | QSPLPPCTPT | PPCAEMREDS | ARVYENVGLM | QQQKSFR |
Кодований геном білок за функціями належить до гідролаз, протеїн-фосфатаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг. Локалізований у цитоплазмі, ядрі.
Література
- Freeman R.M. Jr., Plutzky J., Neel B.G. (1992). Identification of a human src homology 2-containing protein-tyrosine-phosphatase: a putative homolog of Drosophila corkscrew. Proc. Natl. Acad. Sci. U.S.A. 89: 11239—11243. PMID 1280823 DOI:10.1073/pnas.89.23.11239
- Bastien L., Ramachandran C., Liu S., Adam M. (1993). Cloning, expression and mutational analysis of SH-PTP2, human protein-tyrosine phosphatase. Biochem. Biophys. Res. Commun. 196: 124—133. PMID 8216283 DOI:10.1006/bbrc.1993.2224
- Ahmad S., Banville D.L., Zhao Z., Fischer E.H., Shen S.H. (1993). A widely expressed human protein-tyrosine phosphatase containing src homology 2 domains. Proc. Natl. Acad. Sci. U.S.A. 90: 2197—2201. PMID 7681589 DOI:10.1073/pnas.90.6.2197
- Vogel W., Lammers R., Huang J., Ullrich A. (1993). Activation of a phosphotyrosine phosphatase by tyrosine phosphorylation. Science. 259: 1611—1614. PMID 7681217 DOI:10.1126/science.7681217
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Bennett A.M., Tang T.L., Sugimoto S., Walsh C.T., Neel B.G. (1994). Protein-tyrosine-phosphatase SHPTP2 couples platelet-derived growth factor receptor beta to Ras. Proc. Natl. Acad. Sci. U.S.A. 91: 7335—7339. PMID 8041791 DOI:10.1073/pnas.91.15.7335
Примітки
- Захворювання, генетично пов'язані з PTPN11 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:9644 (англ.) . Процитовано 11 вересня 2017.
- (англ.) . Архів оригіналу за 13 вересня 2017. Процитовано 11 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
PTPN11 angl Protein tyrosine phosphatase non receptor type 11 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 12 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 597 aminokislot a molekulyarna masa 68 436 PTPN11Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2SHP 3B7O 3MOW 3O5X 3TKZ 3TL0 4DGP 4DGX 4GWF 4H1O 4JE4 4JEG 3ZM0 3ZM1 3ZM2 3ZM3 4H34 4JMG 4NWF 4NWG 4OHD 4OHE 4OHH 4OHI 4OHL 4PVG 4RDD 4QSY 5DF6 5IBS 5EHP 5EHR 5I6V 5IBMIdentifikatoriSimvoliPTPN11 BPTP3 CFC JMML METCDS NS1 PTP 1D PTP2C SH PTP2 SH PTP3 SHP2 protein tyrosine phosphatase non receptor type 11 protein tyrosine phosphatase non receptor type 11Zovnishni ID OMIM 176876 MGI 99511 HomoloGene 2122 GeneCards PTPN11Pov yazani genetichni zahvoryuvannyajuvenile myelomonocytic leukemia metachondromatosis Ontologiya genaMolekulyarna funkciya phospholipase binding phosphoprotein phosphatase activity insulin receptor binding GO 0098519 GO 0098518 phosphatase activity receptor tyrosine kinase binding peptide hormone receptor binding GO 0001948 GO 0016582 protein binding non membrane spanning protein tyrosine phosphatase activity hydrolase activity phosphatidylinositol 4 5 bisphosphate 3 kinase activity 1 phosphatidylinositol 3 kinase activity cell adhesion molecule binding protein tyrosine phosphatase activity phosphotyrosine residue binding protein domain specific binding D1 dopamine receptor binding insulin receptor substrate binding protein tyrosine kinase binding protein kinase bindingKlitinna komponenta citoplazma gialoplazma mitohondriya klitinne yadro nukleoplazma GO 0009327 protein containing complexBiologichnij proces GO 0098501 GO 0098502 GO 0006286 defosforilyuvannya megakaryocyte development positive regulation of signal transduction negative regulation of insulin secretion regulation of cell adhesion mediated by integrin atrioventricular canal development intestinal epithelial cell migration organ growth epidermal growth factor receptor signaling pathway negative regulation of growth hormone secretion aksonogeneza glucose homeostasis regulation of protein export from nucleus multicellular organism growth regulation of multicellular organism growth lipid metabolism ephrin receptor signaling pathway abortive mitotic cell cycle DNA damage checkpoint signaling GO 0016576 protein dephosphorylation T cell costimulation Trombocitopoez microvillus organization positive regulation of mitotic cell cycle genitalia development platelet activation fibroblast growth factor receptor signaling pathway heart development brain development regulation of type I interferon mediated signaling pathway hormone mediated signaling pathway integrin mediated signaling pathway Bergmann glial cell differentiation homeostasis of number of cells within a tissue inner ear development platelet derived growth factor receptor signaling pathway negative regulation of cortisol secretion peptidyl tyrosine dephosphorylation ERBB signaling pathway negative regulation of hormone secretion triglyceride metabolic process hormone metabolic process positive regulation of hormone secretion negative regulation of cell adhesion mediated by integrin GO 0106159 regulation of protein containing complex assembly face morphogenesis cerebellar cortex formation leukocyte migration multicellular organismal reproductive process phosphatidylinositol phosphate biosynthetic process neurotrophin TRK receptor signaling pathway phosphatidylinositol 3 phosphate biosynthetic process axon guidance positive regulation of ERK1 and ERK2 cascade cellular response to epidermal growth factor stimulus positive regulation of protein kinase B signaling cytokine mediated signaling pathway interleukin 6 mediated signaling pathway cellular response to cytokine stimulus cellular response to mechanical stimulus positive regulation of interferon beta production positive regulation of interleukin 6 production positive regulation of tumor necrosis factor production positive regulation of glucose import GO 1903106 positive regulation of insulin receptor signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5781 19247Ensembl ENSG00000179295 ENSMUSG00000043733UniProt Q06124 P35235RefSeq mRNK NM 002834 NM 080601 NM 001330437 NM 001374625 NM 018508NM 001109992 NM 011202RefSeq bilok NP 001317366 NP 002825 NP 542168 NP 001361554NP 001103462 NP 035332Lokus UCSC Hr 12 112 42 112 51 MbHr 5 121 27 121 33 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGA VTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKY PLNCADPTSERWFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLS VRTGDDKGESNDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKN PMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETTDKVKQGFWEE FETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENS RVIVMTTKEVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRE LKLSKVGQALLQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQ ESIMDAGPVVVHCSAGIGRTGTFIVIDILIDIIREKGVDCDIDVPKTIQM VRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGHEYTNIK YSLADQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQKSFR A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do gidrolaz proteyin fosfataz fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak acetilyuvannya alternativnij splajsing Lokalizovanij u citoplazmi yadri LiteraturaFreeman R M Jr Plutzky J Neel B G 1992 Identification of a human src homology 2 containing protein tyrosine phosphatase a putative homolog of Drosophila corkscrew Proc Natl Acad Sci U S A 89 11239 11243 PMID 1280823 DOI 10 1073 pnas 89 23 11239 Bastien L Ramachandran C Liu S Adam M 1993 Cloning expression and mutational analysis of SH PTP2 human protein tyrosine phosphatase Biochem Biophys Res Commun 196 124 133 PMID 8216283 DOI 10 1006 bbrc 1993 2224 Ahmad S Banville D L Zhao Z Fischer E H Shen S H 1993 A widely expressed human protein tyrosine phosphatase containing src homology 2 domains Proc Natl Acad Sci U S A 90 2197 2201 PMID 7681589 DOI 10 1073 pnas 90 6 2197 Vogel W Lammers R Huang J Ullrich A 1993 Activation of a phosphotyrosine phosphatase by tyrosine phosphorylation Science 259 1611 1614 PMID 7681217 DOI 10 1126 science 7681217 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Bennett A M Tang T L Sugimoto S Walsh C T Neel B G 1994 Protein tyrosine phosphatase SHPTP2 couples platelet derived growth factor receptor beta to Ras Proc Natl Acad Sci U S A 91 7335 7339 PMID 8041791 DOI 10 1073 pnas 91 15 7335PrimitkiZahvoryuvannya genetichno pov yazani z PTPN11 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 9644 angl Procitovano 11 veresnya 2017 angl Arhiv originalu za 13 veresnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 12 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi