CASP1 (англ. Caspase 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми. Довжина поліпептидного ланцюга білка становить 404 амінокислот, а молекулярна маса — 45 159.
CASP1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CASP1, ICE, IL1BC, P45, caspase 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 147678 MGI: 96544 HomoloGene: 133272 GeneCards: CASP1 | ||||||||||||||||
3.4.22.36 | |||||||||||||||||
| |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 11: 105.03 – 105.04 Mb | Хр. 9: 5.3 – 5.31 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MADKVLKEKR | KLFIRSMGEG | TINGLLDELL | QTRVLNKEEM | EKVKRENATV | ||||
MDKTRALIDS | VIPKGAQACQ | ICITYICEED | SYLAGTLGLS | ADQTSGNYLN | ||||
MQDSQGVLSS | FPAPQAVQDN | PAMPTSSGSE | GNVKLCSLEE | AQRIWKQKSA | ||||
EIYPIMDKSS | RTRLALIICN | EEFDSIPRRT | GAEVDITGMT | MLLQNLGYSV | ||||
DVKKNLTASD | MTTELEAFAH | RPEHKTSDST | FLVFMSHGIR | EGICGKKHSE | ||||
QVPDILQLNA | IFNMLNTKNC | PSLKDKPKVI | IIQACRGDSP | GVVWFKDSVG | ||||
VSGNLSLPTT | EEFEDDAIKK | AHIEKDFIAF | CSSTPDNVSW | RHPTMGSVFI | ||||
GRLIEHMQEY | ACSCDVEEIF | RKVRFSFEQP | DGRAQMPTTE | RVTLTRCFYL | ||||
FPGH |
Кодований геном білок за функціями належить до гідролаз, протеаз, тіолових протеаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, альтернативний сплайсинг. Локалізований у цитоплазмі.
Література
- Alnemri E.S., Fernandes-Alnemri T., Litwack G. (1995). Cloning and expression of four novel isoforms of human interleukin-1 beta converting enzyme with different apoptotic activities. J. Biol. Chem. 270: 4312—4317. PMID 7876192 DOI:10.1074/jbc.270.9.4312
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Feng Q., Li P., Leung P.C.K., Auersperg N. (2004). Caspase-1 zeta, a new splice variant of caspase-1 gene. Genomics. 84: 587—591. PMID 15498465 DOI:10.1016/j.ygeno.2004.06.005
- Humke E.W., Shriver S.K., Starovasnik M.A., Fairbrother W.J., Dixit V.M. (2000). ICEBERG: a novel inhibitor of interleukin-1beta generation. Cell. 103: 99—111. PMID 11051551 DOI:10.1016/S0092-8674(00)00108-2
- Romanowski M.J., Scheer J.M., O'Brien T., McDowell R.S. (2004). Crystal structures of a ligand-free and malonate-bound human caspase-1: implications for the mechanism of substrate binding. Structure. 12: 1361—1371. PMID 15296730 DOI:10.1016/j.str.2004.05.010
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 22 вересня 2017. Процитовано 8 вересня 2017.
- (англ.) . Архів оригіналу за 21 вересня 2017. Процитовано 8 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CASP1 angl Caspase 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 11 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 404 aminokislot a molekulyarna masa 45 159 CASP1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1BMQ 1IBC 1ICE 1RWK 1RWM 1RWN 1RWO 1RWP 1RWV 1RWW 1RWX 1SC1 1SC3 1SC4 2FQQ 2H48 2H4W 2H4Y 2H51 2H54 2HBQ 2HBR 2HBY 2HBZ 3D6F 3D6H 3D6M 3E4C 3NS7 5FNAIdentifikatoriSimvoliCASP1 ICE IL1BC P45 caspase 1Zovnishni ID OMIM 147678 MGI 96544 HomoloGene 133272 GeneCards CASP13 4 22 36Ontologiya genaMolekulyarna funkciya cysteine type peptidase activity endopeptidase activity GO 0070122 peptidase activity GO 0001948 GO 0016582 protein binding cysteine type endopeptidase activator activity involved in apoptotic process hydrolase activity cysteine type endopeptidase activity involved in execution phase of apoptosis cysteine type endopeptidase activity involved in apoptotic process kinase binding cysteine type endopeptidase activity CARD domain binding identical protein binding cysteine type endopeptidase activity involved in apoptotic signaling pathwayKlitinna komponenta NLRP3 inflammasome complex citoplazma gialoplazma NLRP1 inflammasome complex extracellular region AIM2 inflammasome complex mitohondriya IPAF inflammasome complex protease inhibitor complex GO 0009327 protein containing complexBiologichnij proces cellular response to organic substance response to ATP response to hypoxia response to bacterium membrane hyperpolarization Piroptoz protein processing toxin transport proteoliz cellular response to mechanical stimulus response to lipopolysaccharide regulation of autophagy interleukin 1 beta production mitochondrial depolarization programmed necrotic cell death GO 0072468 signalna transdukciya GO 0097285 apoptoz regulation of apoptotic process activation of cysteine type endopeptidase activity involved in apoptotic process regulation of inflammatory response execution phase of apoptosis cellular response to lipopolysaccharide cellular response to interferon gamma protein autoprocessing positive regulation of cysteine type endopeptidase activity involved in apoptotic process positive regulation of tumor necrosis factor mediated signaling pathway positive regulation of I kappaB kinase NF kappaB signaling cytokine mediated signaling pathway cellular response to cytokine stimulus apoptotic signaling pathway positive regulation of interleukin 1 beta productionDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez834 12362Ensembl ENSG00000137752 ENSMUSG00000025888UniProt P29466 P29452RefSeq mRNK NM 001223 NM 001257118 NM 001257119 NM 033292 NM 033293NM 033294 NM 033295NM 009807RefSeq bilok NP 001214 NP 001244047 NP 001244048 NP 150634 NP 150635NP 150636 NP 150637NP 033937Lokus UCSC Hr 11 105 03 105 04 MbHr 9 5 3 5 31 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATV MDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLN MQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSA EIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSV DVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSE QVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVG VSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFI GRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYL FPGH A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do gidrolaz proteaz tiolovih proteaz fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak apoptoz alternativnij splajsing Lokalizovanij u citoplazmi LiteraturaAlnemri E S Fernandes Alnemri T Litwack G 1995 Cloning and expression of four novel isoforms of human interleukin 1 beta converting enzyme with different apoptotic activities J Biol Chem 270 4312 4317 PMID 7876192 DOI 10 1074 jbc 270 9 4312 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Feng Q Li P Leung P C K Auersperg N 2004 Caspase 1 zeta a new splice variant of caspase 1 gene Genomics 84 587 591 PMID 15498465 DOI 10 1016 j ygeno 2004 06 005 Humke E W Shriver S K Starovasnik M A Fairbrother W J Dixit V M 2000 ICEBERG a novel inhibitor of interleukin 1beta generation Cell 103 99 111 PMID 11051551 DOI 10 1016 S0092 8674 00 00108 2 Romanowski M J Scheer J M O Brien T McDowell R S 2004 Crystal structures of a ligand free and malonate bound human caspase 1 implications for the mechanism of substrate binding Structure 12 1361 1371 PMID 15296730 DOI 10 1016 j str 2004 05 010PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 22 veresnya 2017 Procitovano 8 veresnya 2017 angl Arhiv originalu za 21 veresnya 2017 Procitovano 8 veresnya 2017 Div takozhHromosoma 11 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi