Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

CD74 англ CD74 molecule білок який кодується однойменним геном розташованим у людей на короткому плечі 5 ї хромосоми Дов

CD74

CD74

CD74 (англ. CD74 molecule) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. Довжина поліпептидного ланцюга білка становить 296 амінокислот, а молекулярна маса — 33 516.

CD74
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CD74, DHLAG, HLADG, II, Ia-GAMMA, CD74 molecule, p33, CLIP
Зовнішні ІД OMIM: 142790 MGI: 96534 HomoloGene: 3209 GeneCards: CD74
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
972
16149
Ensembl
ENSG00000019582
ENSMUSG00000024610
UniProt
P04233
P04441
RefSeq (мРНК)
NM_004355
NM_001025158
NM_001025159
NM_001364083
NM_001364084
NM_001042605
NM_010545
RefSeq (білок)
NP_001020329
NP_001020330
NP_004346
NP_001351012
NP_001351013
NP_001036070
NP_034675
Локус (UCSC) Хр. 5: 150.4 – 150.41 Mb Хр. 18: 60.94 – 60.95 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALY
TGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKP
PKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNAD
PLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQ
KPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYC
WCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM

Кодований геном білок за функціями належить до шаперонів, фосфопротеїнів. Задіяний у таких біологічних процесах як адаптивний імунітет, імунітет, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані, ендоплазматичному ретикулумі, лізосомі, апараті гольджі, ендосомах.

Література

  • Claesson L., Larhammar D., Rask L., Peterson P.A. (1983). cDNA clone for the human invariant gamma chain of class II histocompatibility antigens and its implications for the protein structure. Proc. Natl. Acad. Sci. U.S.A. 80: 7395—7399. PMID 6324166 DOI:10.1073/pnas.80.24.7395
  • Kudo J., Chao L.-Y., Narni F., Saunders G.F. (1985). Structure of the human gene encoding the invariant gamma-chain of class II histocompatibility antigens. Nucleic Acids Res. 13: 8827—8841. PMID 3001652 DOI:10.1093/nar/13.24.8827
  • O'Sullivan D.M., Larhammar D., Wilson M.C., Peterson P.A., Quaranta V. (1986). Structure of the human Ia-associated invariant (gamma)-chain gene: identification of 5' sequences shared with major histocompatibility complex class II genes. Proc. Natl. Acad. Sci. U.S.A. 83: 4484—4488. PMID 3459184 DOI:10.1073/pnas.83.12.4484
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Riberdy J.M., Newcomb J.R., Surman M.J., Barbosa J.A., Cresswell P. (1992). HLA-DR molecules from an antigen-processing mutant cell line are associated with invariant chain peptides. Nature. 360: 474—477. PMID 1448172 DOI:10.1038/360474a0
  • Berger A.C., Roche P.A. (2009). MHC class II transport at a glance. J. Cell Sci. 122: 1—4. PMID 19092054 DOI:10.1242/jcs.035089

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. (англ.) . Архів оригіналу за 18 липня 2017. Процитовано 31 серпня 2017.
  4. (англ.) . Архів оригіналу за 9 вересня 2017. Процитовано 31 серпня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

CD74 angl CD74 molecule bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 5 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 296 aminokislot a molekulyarna masa 33 516 CD74Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1A6A 1ICF 1IIE 1L3H 1MUJ 3PDO 3PGC 3PGD 3QXA 3QXD 4AEN 4X5WIdentifikatoriSimvoliCD74 DHLAG HLADG II Ia GAMMA CD74 molecule p33 CLIPZovnishni ID OMIM 142790 MGI 96534 HomoloGene 3209 GeneCards CD74Ontologiya genaMolekulyarna funkciya nitric oxide synthase binding identical protein binding MHC class II protein binding via antigen binding groove GO 0016518 cytokine receptor activity macrophage migration inhibitory factor binding protein folding chaperone activity MHC class II protein complex binding amyloid beta binding GO 0001948 GO 0016582 protein binding MHC class II protein binding GO 0019974 cytokine binding CD4 receptor bindingKlitinna komponenta lysosomal lumen ekzosoma MHC class II protein complex lysosomal membrane late endosome endocytic vesicle membrane transport vesicle membrane integral component of membrane ER to Golgi transport vesicle membrane multivesicular body kompleks Goldzhi Golgi membrane trans Golgi network membrane macrophage migration inhibitory factor receptor complex membrana cell surface vnutrishnoklitinnij integral component of lumenal side of endoplasmic reticulum membrane endoplazmatichnij retikulum endoplasmic reticulum membrane klitinna membrana lizosoma vakuolya endosoma clathrin coated endocytic vesicle membrane NOS2 CD74 complex external side of plasma membraneBiologichnij proces GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid positive regulation of T cell differentiation negative regulation of apoptotic process GO 0072468 signalna transdukciya positive thymic T cell selection chaperone cofactor dependent protein refolding T cell selection positive regulation of type 2 immune response positive regulation of dendritic cell antigen processing and presentation antigen processing and presentation of exogenous peptide antigen via MHC class II adaptivna imunna vidpovid antigen processing and presentation positive regulation of peptidyl tyrosine phosphorylation negative regulation of mature B cell apoptotic process regulation of macrophage activation negative regulation of DNA damage response signal transduction by p53 class mediator immunoglobulin mediated immune response leukocyte migration positive regulation of neutrophil chemotaxis positive regulation of chemokine C X C motif ligand 2 production macrophage migration inhibitory factor signaling pathway prostaglandin biosynthetic process proliferaciya antigen processing and presentation of endogenous antigen proces imunnoyi sistemi defense response negative regulation of peptide secretion negative regulation of T cell differentiation positive regulation of macrophage cytokine production positive regulation of B cell proliferation negative thymic T cell selection positive regulation of fibroblast proliferation intracellular protein transport positive regulation of ERK1 and ERK2 cascade negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator positive regulation of cytokine mediated signaling pathway positive regulation of protein phosphorylation positive regulation of kinase activity positive regulation of I kappaB kinase NF kappaB signaling positive regulation of MAPK cascade positive regulation of monocyte differentiation GO 0060469 GO 0009371 positive regulation of transcription DNA templated positive regulation of viral entry into host cell protein heterotetramerization protein trimerization GO 0034622 protein containing complex assemblyDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez972 16149Ensembl ENSG00000019582 ENSMUSG00000024610UniProt P04233 P04441RefSeq mRNK NM 004355 NM 001025158 NM 001025159 NM 001364083 NM 001364084NM 001042605 NM 010545RefSeq bilok NP 001020329 NP 001020330 NP 004346 NP 001351012 NP 001351013NP 001036070 NP 034675Lokus UCSC Hr 5 150 4 150 41 MbHr 18 60 94 60 95 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALY TGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKP PKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNAD PLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQ KPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYC WCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do shaperoniv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak adaptivnij imunitet imunitet alternativnij splajsing Lokalizovanij u klitinnij membrani membrani endoplazmatichnomu retikulumi lizosomi aparati goldzhi endosomah LiteraturaClaesson L Larhammar D Rask L Peterson P A 1983 cDNA clone for the human invariant gamma chain of class II histocompatibility antigens and its implications for the protein structure Proc Natl Acad Sci U S A 80 7395 7399 PMID 6324166 DOI 10 1073 pnas 80 24 7395 Kudo J Chao L Y Narni F Saunders G F 1985 Structure of the human gene encoding the invariant gamma chain of class II histocompatibility antigens Nucleic Acids Res 13 8827 8841 PMID 3001652 DOI 10 1093 nar 13 24 8827 O Sullivan D M Larhammar D Wilson M C Peterson P A Quaranta V 1986 Structure of the human Ia associated invariant gamma chain gene identification of 5 sequences shared with major histocompatibility complex class II genes Proc Natl Acad Sci U S A 83 4484 4488 PMID 3459184 DOI 10 1073 pnas 83 12 4484 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Riberdy J M Newcomb J R Surman M J Barbosa J A Cresswell P 1992 HLA DR molecules from an antigen processing mutant cell line are associated with invariant chain peptides Nature 360 474 477 PMID 1448172 DOI 10 1038 360474a0 Berger A C Roche P A 2009 MHC class II transport at a glance J Cell Sci 122 1 4 PMID 19092054 DOI 10 1242 jcs 035089PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 18 lipnya 2017 Procitovano 31 serpnya 2017 angl Arhiv originalu za 9 veresnya 2017 Procitovano 31 serpnya 2017 Div takozhHromosoma 5 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ