CTNNB1 (англ. Catenin beta 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. Довжина поліпептидного ланцюга білка становить 781 амінокислот, а молекулярна маса — 85 497.
CTNNB1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CTNNB1, CTNNB, MRD19, armadillo, catenin beta 1, EVR7, NEDSDV | ||||||||||||||||
Зовнішні ІД | OMIM: 116806 MGI: 88276 HomoloGene: 1434 GeneCards: CTNNB1 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
колоректальний рак, pilomatrixoma, autosomal dominant non-syndromic intellectual disability 19, exudative vitreoretinopathy 7, liver carcinoma, cerebellar medulloblastoma | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 3: 41.19 – 41.26 Mb | Хр. 9: 120.76 – 120.79 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MATQADLMEL | DMAMEPDRKA | AVSHWQQQSY | LDSGIHSGAT | TTAPSLSGKG | ||||
NPEEEDVDTS | QVLYEWEQGF | SQSFTQEQVA | DIDGQYAMTR | AQRVRAAMFP | ||||
ETLDEGMQIP | STQFDAAHPT | NVQRLAEPSQ | MLKHAVVNLI | NYQDDAELAT | ||||
RAIPELTKLL | NDEDQVVVNK | AAVMVHQLSK | KEASRHAIMR | SPQMVSAIVR | ||||
TMQNTNDVET | ARCTAGTLHN | LSHHREGLLA | IFKSGGIPAL | VKMLGSPVDS | ||||
VLFYAITTLH | NLLLHQEGAK | MAVRLAGGLQ | KMVALLNKTN | VKFLAITTDC | ||||
LQILAYGNQE | SKLIILASGG | PQALVNIMRT | YTYEKLLWTT | SRVLKVLSVC | ||||
SSNKPAIVEA | GGMQALGLHL | TDPSQRLVQN | CLWTLRNLSD | AATKQEGMEG | ||||
LLGTLVQLLG | SDDINVVTCA | AGILSNLTCN | NYKNKMMVCQ | VGGIEALVRT | ||||
VLRAGDREDI | TEPAICALRH | LTSRHQEAEM | AQNAVRLHYG | LPVVVKLLHP | ||||
PSHWPLIKAT | VGLIRNLALC | PANHAPLREQ | GAIPRLVQLL | VRAHQDTQRR | ||||
TSMGGTQQQF | VEGVRMEEIV | EGCTGALHIL | ARDVHNRIVI | RGLNTIPLFV | ||||
QLLYSPIENI | QRVAAGVLCE | LAQDKEAAEA | IEAEGATAPL | TELLHSRNEG | ||||
VATYAAAVLF | RMSEDKPQDY | KKRLSVELTS | SLFRTEPMAW | NETADLGLDI | ||||
GAQGEPLGYR | QDDPSYRSFH | SGGYGQDALG | MDPMMEHEMG | GHHPGADYPV | ||||
DGLPDLGHAQ | DLMDGLPPGD | SNQLAWFDTD | L |
Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як клітинна адгезія, транскрипція, регуляція транскрипції, нейрогенез, сигнальний шлях Wnt, поліморфізм, ацетиляція, альтернативний сплайсинг. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, ядрі, мембрані, клітинних контактах, синапсах.
Література
- Huelsken J., Birchmeier W., Behrens J. (1994). E-cadherin and APC compete for the interaction with beta-catenin and the cytoskeleton. J. Cell Biol. 127: 2061—2069. PMID 7806582 DOI:10.1083/jcb.127.6.2061
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Butz S., Kemler R. (1994). Distinct cadherin-catenin complexes in Ca(2+)-dependent cell-cell adhesion. FEBS Lett. 355: 195—200. PMID 7982500 DOI:10.1016/0014-5793(94)01205-9
- Mueller T., Choidas A., Reichmann E., Ullrich A. (1999). Phosphorylation and free pool of beta-catenin are regulated by tyrosine kinases and tyrosine phosphatases during epithelial cell migration. J. Biol. Chem. 274: 10173—10183. PMID 10187801 DOI:10.1074/jbc.274.15.10173
- Moreno-Bueno G., Gamallo C., Perez-Gallego L., Contreras F., Palacios J. (2001). Beta-catenin expression in pilomatrixomas. Relationship with beta-catenin gene mutations and comparison with beta-catenin expression in normal hair follicles. Br. J. Dermatol. 145: 576—581. PMID 11703283 DOI:10.1046/j.1365-2133.2001.04455.x
- Tutter A.V., Fryer C.J., Jones K.A. (2001). Chromatin-specific regulation of LEF-1-beta-catenin transcription activation and inhibition in vitro. Genes Dev. 15: 3342—3354. PMID 11751639 DOI:10.1101/gad.946501
Примітки
- Захворювання, генетично пов'язані з CTNNB1 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 26 березня 2016. Процитовано 30 серпня 2017.
- (англ.) . Архів оригіналу за 29 серпня 2017. Процитовано 30 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CTNNB1 angl Catenin beta 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 3 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 781 aminokislot a molekulyarna masa 85 497 CTNNB1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1G3J 1JDH 1JPW 1LUJ 1P22 1QZ7 1T08 1TH1 2GL7 2Z6H 3DIW 3SL9 3SLA 3TX7 4DJS 3FQN 3FQRIdentifikatoriSimvoliCTNNB1 CTNNB MRD19 armadillo catenin beta 1 EVR7 NEDSDVZovnishni ID OMIM 116806 MGI 88276 HomoloGene 1434 GeneCards CTNNB1Pov yazani genetichni zahvoryuvannyakolorektalnij rak pilomatrixoma autosomal dominant non syndromic intellectual disability 19 exudative vitreoretinopathy 7 liver carcinoma cerebellar medulloblastoma Ontologiya genaMolekulyarna funkciya GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity DNA binding GO 0001948 GO 0016582 protein binding SMAD binding chromatin binding signal transducer activity double stranded DNA binding protein C terminus binding protein kinase binding kinase binding androgen receptor binding transmembrane transporter binding estrogen receptor binding I SMAD binding protein phosphatase binding transcription factor binding GO 0001105 transcription coactivator activity alpha catenin binding enzyme binding RNA polymerase II core promoter sequence specific DNA binding protein heterodimerization activity cadherin binding disordered domain specific bindingKlitinna komponenta Adgezivni kontakti beta catenin destruction complex protein DNA complex lamellipodium beta catenin TCF complex beta catenin TCF7L2 complex centrosoma Z disc bicellular tight junction transcription regulator complex lateral plasma membrane citoplazma cell cortex apical part of cell spindle pole Scrib APC beta catenin complex catenin TCF7L2 complex flotillin complex intercalated disc klitinne yadro cell cell junction membrana Wnt signalosome basolateral plasma membrane klitinna membrana citoskelet ekzosoma nukleoplazma centr organizaciyi mikrotrubochok cell periphery apical junction complex cell projection membrane focal adhesion microvillus membrane fascia adherens gialoplazma mizhklitinni kontakti perinuclear region of cytoplasm catenin complex sinaps vnutrishnoklitinnij GO 0009327 protein containing complex presynaptic membrane cell projection postsynaptic membrane Schaffer collateral CA1 synapse presynaptic active zone cytoplasmic component postsynaptic density intracellular componentBiologichnij proces embryonic brain development negative regulation of cell population proliferation renal vesicle formation positive regulation of MAPK cascade proximal distal pattern formation positive regulation of neuroblast proliferation chemical synaptic transmission central nervous system vasculogenesis renal inner medulla development transcription DNA templated positive regulation of neuron apoptotic process canonical Wnt signaling pathway embryonic foregut morphogenesis endoderm formation endodermal cell fate commitment synapse organization trachea formation GO 0006928 klitinnij proces positive regulation of telomere maintenance via telomerase neural plate development negative regulation of protein sumoylation lung cell differentiation vaskulogenez lung induction krovotvorennya rozvitok nirki GO 1901313 positive regulation of gene expression adherens junction organization renal outer medulla development thymus development regulation of myelination positive regulation of cell population proliferation epithelial tube branching involved in lung morphogenesis kistkova rezorbciya epithelial cell differentiation involved in prostate gland development regulation of euchromatin binding hair follicle morphogenesis hair follicle placode formation neuron migration negative regulation of chondrocyte differentiation fungiform papilla formation positive regulation of type I interferon production negative regulation of mitotic cell cycle embryonic ectoderm development trachea morphogenesis T cell differentiation in thymus pancreas development cranial ganglion development regulation of apoptotic process lung development positive regulation of skeletal muscle tissue development synaptic vesicle transport positive regulation of telomerase activity morphogenesis of embryonic epithelium renal system development oocyte development hair cycle process embryonic axis specification embryonic forelimb morphogenesis anterior posterior axis specification positive regulation of endothelial cell differentiation GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II animal organ development negative regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis dorsal ventral axis specification positive regulation of muscle cell differentiation positive regulation of apoptotic process regulation of protein localization to cell surface androgen receptor signaling pathway nejrobiologiya rozvitku forebrain development hair cell differentiation GO 1901227 negative regulation of transcription by RNA polymerase II regulation of epithelial cell differentiation positive regulation of histone H3 K4 methylation embryonic digit morphogenesis endothelial tube morphogenesis osteoclast differentiation GO 0009373 regulation of transcription DNA templated regulation of osteoclast differentiation neuron differentiation Epitelialno mezenhimalnij perehid cell fate specification odontogenesis of dentin containing tooth midbrain development positive regulation of mesenchymal cell proliferation positive regulation of heparan sulfate proteoglycan biosynthetic process smooth muscle cell differentiation glial cell fate determination Determinaciya positive regulation of determination of dorsal identity regulation of T cell proliferation gastrulation with mouth forming second negative regulation of apoptotic signaling pathway oviduct development cellular response to growth factor stimulus male genitalia development negative regulation of gene expression nephron tubule formation regulation of osteoblast differentiation regulation of angiogenesis cell morphogenesis involved in differentiation cell matrix adhesion dorsal root ganglion development regulation of cell population proliferation embryonic skeletal limb joint morphogenesis heart development T cell differentiation dorsal ventral pattern formation layer formation in cerebral cortex canonical Wnt signaling pathway involved in positive regulation of cardiac outflow tract cell proliferation canonical Wnt signaling pathway involved in positive regulation of epithelial to mesenchymal transition positive regulation of osteoblast differentiation negative regulation of osteoclast differentiation regulation of core promoter binding genitalia morphogenesis negative regulation of neuron death cell maturation proliferaciya branching involved in ureteric bud morphogenesis diferenciaciya klitin protein localization to cell surface embryonic hindlimb morphogenesis negative regulation of oligodendrocyte differentiation metanephros morphogenesis regulation of centriole centriole cohesion limb development positive regulation of epithelial cell proliferation involved in prostate gland development regulation of secondary heart field cardioblast proliferation regulation of fibroblast proliferation regulation of smooth muscle cell proliferation skin development skeletal system development hindbrain development regulation of calcium ion import mesenchymal cell proliferation involved in lung development regulation of nephron tubule epithelial cell differentiation cellular response to indole 3 methanol canonical Wnt signaling pathway involved in negative regulation of apoptotic process regulyaciya ekspresiyi geniv regulyaciya diferenciyuvannya klitin stem cell population maintenance regulation of neurogenesis in utero embryonic development lung associated mesenchyme development negative regulation of cell differentiation positive regulation of I kappaB kinase NF kappaB signaling vasculature development sympathetic ganglion development positive regulation of epithelial cell differentiation positive regulation of branching involved in lung morphogenesis lens morphogenesis in camera type eye positive regulation of epithelial to mesenchymal transition positive regulation of fibroblast growth factor receptor signaling pathway embryonic heart tube development regulation of centromeric sister chromatid cohesion positive regulation of DNA templated transcription initiation GO 0060469 GO 0009371 positive regulation of transcription DNA templated branching involved in blood vessel morphogenesis positive regulation of DNA binding transcription factor activity adgeziya klitin GO 0045996 negative regulation of transcription DNA templated adherens junction assembly GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II Wnt signaling pathway calcium modulating pathway beta catenin TCF complex assembly beta catenin destruction complex disassembly cranial skeletal system development proteasome mediated ubiquitin dependent protein catabolic process Wnt signaling pathway canonical Wnt signaling pathway involved in midbrain dopaminergic neuron differentiation response to estradiol midbrain dopaminergic neuron differentiation entry of bacterium into host cell negative regulation of oxidative stress induced neuron death positive regulation of core promoter binding GO 0022415 viral process negative regulation of angiogenesis negative regulation of epithelial cell differentiation negative regulation of apoptotic process positive regulation of molecular function positive regulation of epithelial cell proliferation negative regulation of neurogenesis regulation of timing of anagen regulation of canonical Wnt signaling pathway synaptic vesicle clustering cell cell adhesion neuron projection extension positive regulation of neural precursor cell proliferation protein polyubiquitination tissue homeostasisDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1499 12387Ensembl ENSG00000168036 ENSMUSG00000006932UniProt P35222 Q02248RefSeq mRNK NM 001098209 NM 001098210 NM 001904 NM 001330729NM 001165902 NM 007614RefSeq bilok NP 001091679 NP 001091680 NP 001317658 NP 001895NP 001159374 NP 031640Lokus UCSC Hr 3 41 19 41 26 MbHr 9 120 76 120 79 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKG NPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFP ETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELAT RAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVR TMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDS VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVC SSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEG LLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRT VLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHP PSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRR TSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEG VATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDI GAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPV DGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do aktivatoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak klitinna adgeziya transkripciya regulyaciya transkripciyi nejrogenez signalnij shlyah Wnt polimorfizm acetilyaciya alternativnij splajsing Lokalizovanij u klitinnij membrani citoplazmi citoskeleti yadri membrani klitinnih kontaktah sinapsah LiteraturaHuelsken J Birchmeier W Behrens J 1994 E cadherin and APC compete for the interaction with beta catenin and the cytoskeleton J Cell Biol 127 2061 2069 PMID 7806582 DOI 10 1083 jcb 127 6 2061 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Butz S Kemler R 1994 Distinct cadherin catenin complexes in Ca 2 dependent cell cell adhesion FEBS Lett 355 195 200 PMID 7982500 DOI 10 1016 0014 5793 94 01205 9 Mueller T Choidas A Reichmann E Ullrich A 1999 Phosphorylation and free pool of beta catenin are regulated by tyrosine kinases and tyrosine phosphatases during epithelial cell migration J Biol Chem 274 10173 10183 PMID 10187801 DOI 10 1074 jbc 274 15 10173 Moreno Bueno G Gamallo C Perez Gallego L Contreras F Palacios J 2001 Beta catenin expression in pilomatrixomas Relationship with beta catenin gene mutations and comparison with beta catenin expression in normal hair follicles Br J Dermatol 145 576 581 PMID 11703283 DOI 10 1046 j 1365 2133 2001 04455 x Tutter A V Fryer C J Jones K A 2001 Chromatin specific regulation of LEF 1 beta catenin transcription activation and inhibition in vitro Genes Dev 15 3342 3354 PMID 11751639 DOI 10 1101 gad 946501PrimitkiZahvoryuvannya genetichno pov yazani z CTNNB1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 26 bereznya 2016 Procitovano 30 serpnya 2017 angl Arhiv originalu za 29 serpnya 2017 Procitovano 30 serpnya 2017 Div takozhHromosoma 3 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi