Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

NKX2 5 англ NK2 homeobox 5 білок який кодується однойменним геном розташованим у людей на короткому плечі 5 ї хромосоми

Nkx2-5

Nkx2-5

NKX2-5 (англ. NK2 homeobox 5) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. Довжина поліпептидного ланцюга білка становить 324 амінокислот, а молекулярна маса — 34 918.

NKX2-5
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NKX2-5, CHNG5, CSX, CSX1, HLHS2, NKX2.5, NKX2E, NKX4-1, VSD3, NK2 homeobox 5
Зовнішні ІД OMIM: 600584 MGI: 97350 HomoloGene: 3230 GeneCards: NKX2-5
Пов'язані генетичні захворювання
atrial heart septal defect 7, тетрада Фалло
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
1482
18091
Ensembl
ENSG00000183072
ENSMUSG00000015579
UniProt
P52952
P42582
RefSeq (мРНК)
NM_004387
NM_001166175
NM_001166176
NM_008700
RefSeq (білок)
NP_001159647
NP_001159648
NP_004378
NP_032726
Локус (UCSC) Хр. 5: 173.23 – 173.24 Mb Хр. 17: 27.06 – 27.06 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAA
FKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDP
DPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQV
YELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQ
TLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGY
NAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDL
NAVQSPGIPQSNSGVSTLHGIRAW

Кодований геном білок за функцією належить до . Задіяний у таких біологічних процесах як поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Goldmuntz E., Geiger E., Benson D.W. (2001). NKX2.5 mutations in patients with tetralogy of fallot. Circulation. 104: 2565—2568. PMID 11714651 DOI:10.1161/hc4601.098427
  • McElhinney D.B., Geiger E., Blinder J., Benson D.W., Goldmuntz E. (2003). NKX2.5 mutations in patients with congenital heart disease. J. Am. Coll. Cardiol. 42: 1650—1655. PMID 14607454 DOI:10.1016/j.jacc.2003.05.004
  • Reamon-Buettner S.M., Borlak J. (2004). Somatic NKX2-5 mutations as a novel mechanism of disease in complex congenital heart disease. J. Med. Genet. 41: 684—690. PMID 15342699 DOI:10.1136/jmg.2003.017483
  • Peng T., Wang L., Zhou S.F., Li X. (2010). Mutations of the GATA4 and NKX2.5 genes in Chinese pediatric patients with non-familial congenital heart disease. Genetica. 138: 1231—1240. PMID 21110066 DOI:10.1007/s10709-010-9522-4
  • Turbay D., Wechsler S.B., Blanchard K.M., Izumo S. (1996). Molecular cloning, chromosomal mapping, and characterization of the human cardiac-specific homeobox gene hCsx. Mol. Med. 2: 86—96. PMID 8900537

Примітки

  1. Захворювання, генетично пов'язані з NKX2-5 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:2488 (англ.) . Процитовано 31 серпня 2017.
  5. (англ.) . Архів оригіналу за 17 червня 2017. Процитовано 31 серпня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

NKX2 5 angl NK2 homeobox 5 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 5 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 324 aminokislot a molekulyarna masa 34 918 NKX2 5Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB3RKQ 4S0HIdentifikatoriSimvoliNKX2 5 CHNG5 CSX CSX1 HLHS2 NKX2 5 NKX2E NKX4 1 VSD3 NK2 homeobox 5Zovnishni ID OMIM 600584 MGI 97350 HomoloGene 3230 GeneCards NKX2 5Pov yazani genetichni zahvoryuvannyaatrial heart septal defect 7 tetrada Fallo Ontologiya genaMolekulyarna funkciya GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity GO 0001077 GO 0001212 GO 0001213 GO 0001211 GO 0001205 DNA binding transcription activator activity RNA polymerase II specific transcription factor binding protein homodimerization activity serum response element binding chromatin binding GO 0001948 GO 0016582 protein binding DNA binding sequence specific DNA binding GO 0001104 transcription coregulator activity protein heterodimerization activity transcription factor activity RNA polymerase II distal enhancer sequence specific binding GO 0000980 RNA polymerase II cis regulatory region sequence specific DNA binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specificKlitinna komponenta citoplazma klitinne yadro transcription regulator complex RNA polymerase II transcription regulator complex GO 0009327 protein containing complex protein DNA complexBiologichnij proces cardiac conduction system development apoptotic process involved in heart morphogenesis bundle of His development GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II atrioventricular node cell development outflow tract morphogenesis embryonic heart tube development vaskulogenez heart looping atrial septum morphogenesis positive regulation of heart contraction proepicardium development pulmonary myocardium development heart contraction ventricular cardiac muscle cell development negative regulation of canonical Wnt signaling pathway pharyngeal system development atrioventricular node development cardiac ventricle formation GO 0009373 regulation of transcription DNA templated cardiac muscle contraction regulation of cardiac muscle cell proliferation heart trabecula formation ventricular septum morphogenesis cardiac muscle cell differentiation Purkinje myocyte differentiation spleen development GO 0060469 GO 0009371 positive regulation of transcription DNA templated heart development positive regulation of neuron differentiation positive regulation of cardioblast differentiation septum secundum development atrial cardiac muscle cell development diferenciaciya klitin adult heart development right ventricular cardiac muscle tissue morphogenesis negative regulation of apoptotic process GO 1901227 negative regulation of transcription by RNA polymerase II positive regulation of transcription initiation from RNA polymerase II promoter cardiac muscle cell proliferation BMP signaling pathway ventricular trabecula myocardium morphogenesis outflow tract septum morphogenesis negative regulation of cardiac muscle cell apoptotic process thyroid gland development canonical Wnt signaling pathway GO 0045996 negative regulation of transcription DNA templated sarcomere organization cardiac ventricle morphogenesis regulation of cardiac conduction cardiac muscle tissue development embryonic heart tube left right pattern formation heart morphogenesis cardiac muscle tissue morphogenesis multicellular organism development GO 1901313 positive regulation of gene expression positive regulation of cell population proliferation GO 0061423 positive regulation of sodium ion transport negative regulation of myotube differentiation regulation of cardiac muscle contraction ventricular cardiac myofibril assembly atrioventricular node cell fate commitment GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II transcription by RNA polymerase II krovotvorennyaDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1482 18091Ensembl ENSG00000183072 ENSMUSG00000015579UniProt P52952 P42582RefSeq mRNK NM 004387 NM 001166175 NM 001166176NM 008700RefSeq bilok NP 001159647 NP 001159648 NP 004378NP 032726Lokus UCSC Hr 5 173 23 173 24 MbHr 17 27 06 27 06 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAA FKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDP DPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQV YELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQ TLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGY NAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDL NAVQSPGIPQSNSGVSTLHGIRAW A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do Zadiyanij u takih biologichnih procesah yak polimorfizm alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u yadri LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Goldmuntz E Geiger E Benson D W 2001 NKX2 5 mutations in patients with tetralogy of fallot Circulation 104 2565 2568 PMID 11714651 DOI 10 1161 hc4601 098427 McElhinney D B Geiger E Blinder J Benson D W Goldmuntz E 2003 NKX2 5 mutations in patients with congenital heart disease J Am Coll Cardiol 42 1650 1655 PMID 14607454 DOI 10 1016 j jacc 2003 05 004 Reamon Buettner S M Borlak J 2004 Somatic NKX2 5 mutations as a novel mechanism of disease in complex congenital heart disease J Med Genet 41 684 690 PMID 15342699 DOI 10 1136 jmg 2003 017483 Peng T Wang L Zhou S F Li X 2010 Mutations of the GATA4 and NKX2 5 genes in Chinese pediatric patients with non familial congenital heart disease Genetica 138 1231 1240 PMID 21110066 DOI 10 1007 s10709 010 9522 4 Turbay D Wechsler S B Blanchard K M Izumo S 1996 Molecular cloning chromosomal mapping and characterization of the human cardiac specific homeobox gene hCsx Mol Med 2 86 96 PMID 8900537PrimitkiZahvoryuvannya genetichno pov yazani z NKX2 5 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 2488 angl Procitovano 31 serpnya 2017 angl Arhiv originalu za 17 chervnya 2017 Procitovano 31 serpnya 2017 Div takozhHromosoma 5 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ