MECP2 (англ. Methyl-CpG binding protein 2) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі. Довжина поліпептидного ланцюга білка становить 486 амінокислот, а молекулярна маса — 52 441.
MECP2 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | MECP2, AUTSX3, MRX16, MRX79, MRXS13, MRXSL, PPMX, RS, RTS, RTT, methyl-CpG binding protein 2 | ||||||||||||||||
Зовнішні ІД | OMIM: 300005 MGI: 99918 HomoloGene: 3657 GeneCards: MECP2 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
синдром Ангельмана, синдром Ретта, severe neonatal-onset encephalopathy with microcephaly, X-linked intellectual disability-psychosis-macroorchidism syndrome | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. X: 154.02 – 154.14 Mb | Хр. X: 73.07 – 73.18 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MVAGMLGLRE | EKSEDQDLQG | LKDKPLKFKK | VKKDKKEEKE | GKHEPVQPSA | ||||
HHSAEPAEAG | KAETSEGSGS | APAVPEASAS | PKQRRSIIRD | RGPMYDDPTL | ||||
PEGWTRKLKQ | RKSGRSAGKY | DVYLINPQGK | AFRSKVELIA | YFEKVGDTSL | ||||
DPNDFDFTVT | GRGSPSRREQ | KPPKKPKSPK | APGTGRGRGR | PKGSGTTRPK | ||||
AATSEGVQVK | RVLEKSPGKL | LVKMPFQTSP | GGKAEGGGAT | TSTQVMVIKR | ||||
PGRKRKAEAD | PQAIPKKRGR | KPGSVVAAAA | AEAKKKAVKE | SSIRSVQETV | ||||
LPIKKRKTRE | TVSIEVKEVV | KPLLVSTLGE | KSGKGLKTCK | SPGRKSKESS | ||||
PKGRSSSASS | PPKKEHHHHH | HHSESPKAPV | PLLPPLPPPP | PEPESSEDPT | ||||
SPPEPQDLSS | SVCKEEKMPR | GGSLESDGCP | KEPAKTQPAV | ATAATAAEKY | ||||
KHRGEGERKD | IVSSSMPRPN | REEPVDSRTP | VTERVS |
Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.
Література
- Kudo S. (1998). Methyl-CpG-binding protein MeCP2 represses Sp1-activated transcription of the human leukosialin gene when the promoter is methylated. Mol. Cell. Biol. 18: 5492—5499. PMID 9710633 DOI:10.1128/MCB.18.9.5492
- Coy J.F., Sedlacek Z., Baechner D., Delius H., Poustka A. (1999). A complex pattern of evolutionary conservation and alternative polyadenylation within the long 3'-untranslated region of the methyl-CpG-binding protein 2 gene (MeCP2) suggests a regulatory role in gene expression. Hum. Mol. Genet. 8: 1253—1262. PMID 10369871 DOI:10.1093/hmg/8.7.1253
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Kriaucionis S., Bird A. (2004). The major form of MeCP2 has a novel N-terminus generated by alternative splicing. Nucleic Acids Res. 32: 1818—1823. PMID 15034150 DOI:10.1093/nar/gkh349
- Miltenberger-Miltenyi G., Laccone F. (2003). Mutations and polymorphisms in the human methyl CpG-binding protein MECP2. Hum. Mutat. 22: 107—115. PMID 12872250 DOI:10.1002/humu.10243
- Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J. (2008). Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment. J. Proteome Res. 7: 5167—5176. PMID 19367720 DOI:10.1021/pr800500r
Примітки
- Захворювання, генетично пов'язані з MECP2 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:6990 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 17 вересня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
MECP2 angl Methyl CpG binding protein 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na X hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 486 aminokislot a molekulyarna masa 52 441 MECP2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1QK9 3C2IIdentifikatoriSimvoliMECP2 AUTSX3 MRX16 MRX79 MRXS13 MRXSL PPMX RS RTS RTT methyl CpG binding protein 2Zovnishni ID OMIM 300005 MGI 99918 HomoloGene 3657 GeneCards MECP2Pov yazani genetichni zahvoryuvannyasindrom Angelmana sindrom Retta severe neonatal onset encephalopathy with microcephaly X linked intellectual disability psychosis macroorchidism syndrome Ontologiya genaMolekulyarna funkciya double stranded methylated DNA binding GO 0001106 transcription corepressor activity protein domain specific binding protein N terminus binding GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity transcription factor binding siRNA binding mRNA binding chromatin binding GO 0001948 GO 0016582 protein binding DNA binding GO 0001078 GO 0001214 GO 0001206 DNA binding transcription repressor activity RNA polymerase II specific RNA binding methyl CpG bindingKlitinna komponenta postsynapse citoplazma mitohondriya klitinne yadro GO 0035328 Geterohromatin mizhklitinnij prostir gamma tubulin complex centrosoma gialoplazma Hromatin nukleoplazmaBiologichnij proces GO 1904089 negative regulation of neuron apoptotic process multicellular organismal response to stress inositol metabolic process mitochondrial electron transport ubiquinol to cytochrome c post embryonic development navchennya propriocepciya neuron projection development regulation of gene expression by genetic imprinting GO 0009373 regulation of transcription DNA templated patogenez neuromuscular process controlling posture adult locomotory behavior pam yat transcription DNA templated ventricular system development neuron maturation GO 0060469 GO 0009371 positive regulation of transcription DNA templated glutamine metabolic process neuromuscular process histone acetylation excitatory postsynaptic potential nervous system process involved in regulation of systemic arterial blood pressure socialna povedinka synapse assembly chemical synaptic transmission negative regulation of histone methylation perelyak glucocorticoid metabolic process dendrite development GO 1901227 negative regulation of transcription by RNA polymerase II behavioral fear response respiratory gaseous exchange by respiratory system cerebellum development regulation of synaptic plasticity cardiolipin metabolic process neuron differentiation regulyaciya ekspresiyi geniv sensory perception of pain GO 0045996 negative regulation of transcription DNA templated phosphatidylcholine metabolic process visual learning GO 0034613 protein localization response to hypoxia Epigenetichne uspadkuvannya cellular biogenic amine metabolic process regulation of respiratory gaseous exchange by nervous system process brain development dovgotrivala pam yat histone methylation negative regulation of histone acetylation catecholamine secretion dovgotrivala potenciaciya positive regulation of synapse assembly negative regulation of smooth muscle cell differentiation positive regulation of histone H3 K9 trimethylation negative regulation of transcription from RNA polymerase II promoter involved in smooth muscle cell differentiation GO 0043148 mitotic spindle organization locomotory behavior positive regulation of cell population proliferation response to radiation positive regulation of G2 M transition of mitotic cell cycle positive regulation of microtubule nucleation transcription initiation from RNA polymerase II promoter negative regulation of gene expression negative regulation of angiogenesis negative regulation of blood vessel endothelial cell migration positive regulation of DNA methylationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez4204 17257Ensembl ENSG00000169057 ENSMUSG00000031393UniProt P51608 Q9Z2D6RefSeq mRNK NM 001110792 NM 004992 NM 001316337 NM 001369391 NM 001369392NM 001369393 NM 001369394 NM 001386137 NM 001386138 NM 001386139NM 001081979 NM 010788RefSeq bilok NP 001104262 NP 001303266 NP 004983 NP 001356320 NP 001356321NP 001356322 NP 001356323NP 001075448 NP 034918Lokus UCSC Hr X 154 02 154 14 MbHr X 73 07 73 18 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSA HHSAEPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTL PEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSL DPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTTRPK AATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGATTSTQVMVIKR PGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETV LPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESS PKGRSSSASSPPKKEHHHHHHHSESPKAPVPLLPPLPPPPPEPESSEDPT SPPEPQDLSSSVCKEEKMPRGGSLESDGCPKEPAKTQPAVATAATAAEKY KHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do represoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi acetilyuvannya alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u yadri LiteraturaKudo S 1998 Methyl CpG binding protein MeCP2 represses Sp1 activated transcription of the human leukosialin gene when the promoter is methylated Mol Cell Biol 18 5492 5499 PMID 9710633 DOI 10 1128 MCB 18 9 5492 Coy J F Sedlacek Z Baechner D Delius H Poustka A 1999 A complex pattern of evolutionary conservation and alternative polyadenylation within the long 3 untranslated region of the methyl CpG binding protein 2 gene MeCP2 suggests a regulatory role in gene expression Hum Mol Genet 8 1253 1262 PMID 10369871 DOI 10 1093 hmg 8 7 1253 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Kriaucionis S Bird A 2004 The major form of MeCP2 has a novel N terminus generated by alternative splicing Nucleic Acids Res 32 1818 1823 PMID 15034150 DOI 10 1093 nar gkh349 Miltenberger Miltenyi G Laccone F 2003 Mutations and polymorphisms in the human methyl CpG binding protein MECP2 Hum Mutat 22 107 115 PMID 12872250 DOI 10 1002 humu 10243 Carrascal M Ovelleiro D Casas V Gay M Abian J 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment J Proteome Res 7 5167 5176 PMID 19367720 DOI 10 1021 pr800500rPrimitkiZahvoryuvannya genetichno pov yazani z MECP2 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 6990 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 17 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma X Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi