GPR143 (англ. G protein-coupled receptor 143) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі. Довжина поліпептидного ланцюга білка становить 404 амінокислот, а молекулярна маса — 43 878.
GPR143 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Ідентифікатори | |||||||||||||||||
Символи | GPR143, NYS6, OA1, G protein-coupled receptor 143 | ||||||||||||||||
Зовнішні ІД | OMIM: 300808 MGI: 107193 HomoloGene: 230 GeneCards: GPR143 | ||||||||||||||||
Реагує на сполуку | |||||||||||||||||
леводопа | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | н/д | Хр. X: 151.56 – 151.59 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MASPRLGTFC | CPTRDAATQL | VLSFQPRAFH | ALCLGSGGLR | LALGLLQLLP | ||||
GRRPAGPGSP | ATSPPASVRI | LRAAAACDLL | GCLGMVIRST | VWLGFPNFVD | ||||
SVSDMNHTEI | WPAAFCVGSA | MWIQLLYSAC | FWWLFCYAVD | AYLVIRRSAG | ||||
LSTILLYHIM | AWGLATLLCV | EGAAMLYYPS | VSRCERGLDH | AIPHYVTMYL | ||||
PLLLVLVANP | ILFQKTVTAV | ASLLKGRQGI | YTENERRMGA | VIKIRFFKIM | ||||
LVLIICWLSN | IINESLLFYL | EMQTDINGGS | LKPVRTAAKT | TWFIMGILNP | ||||
AQGFLLSLAF | YGWTGCSLGF | QSPRKEIQWE | SLTTSAAEGA | HPSPLMPHEN | ||||
PASGKVSQVG | GQTSDEALSM | LSEGSDASTI | EIHTASESCN | KNEGDPALPT | ||||
HGDL |
Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, . Локалізований у клітинній мембрані, мембрані, лізосомі.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Oetting W.S., King R.A. (1999). Molecular basis of albinism: mutations and polymorphisms of pigmentation genes associated with albinism. Hum. Mutat. 13: 99—115. PMID 10094567 DOI:10.1002/(SICI)1098-1004(1999)13:2<99::AID-HUMU2>3.3.CO;2-3
- Oetting W.S. (2002). New insights into ocular albinism type 1 (OA1): mutations and polymorphisms of the OA1 gene. Hum. Mutat. 19: 85—92. PMID 11793467 DOI:10.1002/humu.10034
- Innamorati G., Piccirillo R., Bagnato P., Palmisano I., Schiaffino M.V. (2006). The melanosomal/lysosomal protein OA1 has properties of a G protein-coupled receptor. Pigment Cell Res. 19: 125—135. PMID 16524428 DOI:10.1111/j.1600-0749.2006.00292.x
- Lopez V.M., Decatur C.L., Stamer W.D., Lynch R.M., McKay B.S. (2008). L-DOPA is an endogenous ligand for OA1. PLoS Biol. 6: E236—E236. PMID 18828673 DOI:10.1371/journal.pbio.0060236
- Giordano F., Bonetti C., Surace E.M., Marigo V., Raposo G. (2009). The ocular albinism type 1 (OA1) G-protein-coupled receptor functions with MART-1 at early stages of melanogenesis to control melanosome identity and composition. Hum. Mol. Genet. 18: 4530—4545. PMID 19717472 DOI:10.1093/hmg/ddp415
Примітки
- Сполуки, які фізично взаємодіють з G protein-coupled receptor 143 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 10 вересня 2015. Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
GPR143 angl G protein coupled receptor 143 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na X hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 404 aminokislot a molekulyarna masa 43 878 GPR143IdentifikatoriSimvoliGPR143 NYS6 OA1 G protein coupled receptor 143Zovnishni ID OMIM 300808 MGI 107193 HomoloGene 230 GeneCards GPR143Reaguye na spolukulevodopa Ontologiya genaMolekulyarna funkciya L DOPA binding G protein coupled receptor activity signal transducer activity dopamine binding tyrosine binding GO 0001948 GO 0016582 protein binding L DOPA receptor activityKlitinna komponenta citoplazma integral component of membrane kompleks Goldzhi membrana Melanosoma melanosome membrane lysosomal membrane apical plasma membrane lizosoma klitinna membranaBiologichnij proces eye pigment biosynthetic process regulation of melanosome transport melanosome localization melanosome organization melanosome transport regulation of calcium mediated signaling regulation of melanosome organization calcium mediated signaling using intracellular calcium source phosphatidylinositol mediated signaling GO 0072468 signalna transdukciya zir neuropeptide signaling pathway G protein coupled receptor signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez4935 18241Ensembl n d ENSMUSG00000025333UniProt P51810 P70259RefSeq mRNK NM 000273NM 010951RefSeq bilok NP 000264NP 035081Lokus UCSC n dHr X 151 56 151 59 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLP GRRPAGPGSPATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVD SVSDMNHTEIWPAAFCVGSAMWIQLLYSACFWWLFCYAVDAYLVIRRSAG LSTILLYHIMAWGLATLLCVEGAAMLYYPSVSRCERGLDHAIPHYVTMYL PLLLVLVANPILFQKTVTAVASLLKGRQGIYTENERRMGAVIKIRFFKIM LVLIICWLSNIINESLLFYLEMQTDINGGSLKPVRTAAKTTWFIMGILNP AQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHEN PASGKVSQVGGQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPT HGDL A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv g bilokspryazhenih receptoriv Lokalizovanij u klitinnij membrani membrani lizosomi LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Oetting W S King R A 1999 Molecular basis of albinism mutations and polymorphisms of pigmentation genes associated with albinism Hum Mutat 13 99 115 PMID 10094567 DOI 10 1002 SICI 1098 1004 1999 13 2 lt 99 AID HUMU2 gt 3 3 CO 2 3 Oetting W S 2002 New insights into ocular albinism type 1 OA1 mutations and polymorphisms of the OA1 gene Hum Mutat 19 85 92 PMID 11793467 DOI 10 1002 humu 10034 Innamorati G Piccirillo R Bagnato P Palmisano I Schiaffino M V 2006 The melanosomal lysosomal protein OA1 has properties of a G protein coupled receptor Pigment Cell Res 19 125 135 PMID 16524428 DOI 10 1111 j 1600 0749 2006 00292 x Lopez V M Decatur C L Stamer W D Lynch R M McKay B S 2008 L DOPA is an endogenous ligand for OA1 PLoS Biol 6 E236 E236 PMID 18828673 DOI 10 1371 journal pbio 0060236 Giordano F Bonetti C Surace E M Marigo V Raposo G 2009 The ocular albinism type 1 OA1 G protein coupled receptor functions with MART 1 at early stages of melanogenesis to control melanosome identity and composition Hum Mol Genet 18 4530 4545 PMID 19717472 DOI 10 1093 hmg ddp415PrimitkiSpoluki yaki fizichno vzayemodiyut z G protein coupled receptor 143 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 10 veresnya 2015 Procitovano 12 veresnya 2017 angl Arhiv originalu za 8 serpnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma X Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi