FGFR2 (англ. Fibroblast growth factor receptor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми. Довжина поліпептидного ланцюга білка становить 821 амінокислот, а молекулярна маса — 92 025.
FGFR2 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | FGFR2, BBDS, BEK, BFR-1, CD332, CEK3, CFD1, ECT1, JWS, K-SAM, KGFR, TK14, TK25, fibroblast growth factor receptor 2 | ||||||||||||||||
Зовнішні ІД | OMIM: 176943 MGI: 95523 HomoloGene: 22566 GeneCards: FGFR2 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
рак молочної залози, Crouzon syndrone, Jackson–Weiss syndrome, Beare-Stevenson cutis gyrata syndrome, McGillivray syndrome, LADD syndrome, синдром Антлі—Бікслера, Краніосиностоз | |||||||||||||||||
Реагує на сполуку | |||||||||||||||||
Нінтеданіб, Нінтеданіб, infigratinib, brivanib, erdafitinib, lucitanib, orantinib | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 10: 121.48 – 121.6 Mb | Хр. 7: 129.76 – 132.73 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MVSWGRFICL | VVVTMATLSL | ARPSFSLVED | TTLEPEEPPT | KYQISQPEVY | ||||
VAAPGESLEV | RCLLKDAAVI | SWTKDGVHLG | PNNRTVLIGE | YLQIKGATPR | ||||
DSGLYACTAS | RTVDSETWYF | MVNVTDAISS | GDDEDDTDGA | EDFVSENSNN | ||||
KRAPYWTNTE | KMEKRLHAVP | AANTVKFRCP | AGGNPMPTMR | WLKNGKEFKQ | ||||
EHRIGGYKVR | NQHWSLIMES | VVPSDKGNYT | CVVENEYGSI | NHTYHLDVVE | ||||
RSPHRPILQA | GLPANASTVV | GGDVEFVCKV | YSDAQPHIQW | IKHVEKNGSK | ||||
YGPDGLPYLK | VLKAAGVNTT | DKEIEVLYIR | NVTFEDAGEY | TCLAGNSIGI | ||||
SFHSAWLTVL | PAPGREKEIT | ASPDYLEIAI | YCIGVFLIAC | MVVTVILCRM | ||||
KNTTKKPDFS | SQPAVHKLTK | RIPLRRQVTV | SAESSSSMNS | NTPLVRITTR | ||||
LSSTADTPML | AGVSEYELPE | DPKWEFPRDK | LTLGKPLGEG | CFGQVVMAEA | ||||
VGIDKDKPKE | AVTVAVKMLK | DDATEKDLSD | LVSEMEMMKM | IGKHKNIINL | ||||
LGACTQDGPL | YVIVEYASKG | NLREYLRARR | PPGMEYSYDI | NRVPEEQMTF | ||||
KDLVSCTYQL | ARGMEYLASQ | KCIHRDLAAR | NVLVTENNVM | KIADFGLARD | ||||
INNIDYYKKT | TNGRLPVKWM | APEALFDRVY | THQSDVWSFG | VLMWEIFTLG | ||||
GSPYPGIPVE | ELFKLLKEGH | RMDKPANCTN | ELYMMMRDCW | HAVPSQRPTF | ||||
KQLVEDLDRI | LTLTTNEEYL | DLSQPLEQYS | PSYPDTRSSC | SSGDDSVFSP | ||||
DPMPYEPCLP | QYPHINGSVK | T |
Кодований геном білок за функціями належить до трансфераз, кіназ, рецепторів, тирозинових протеїнкіназ, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами, з молекулою гепарину. Локалізований у клітинній мембрані, мембрані, цитоплазматичних везикулах, апараті гольджі. Також секретований назовні.
Література
- Seno M., Sasada R., Watanabe T., Ishimaru K., Igarashi K. (1991). Two cDNAs encoding novel human FGF receptor. Biochim. Biophys. Acta. 1089: 244—246. PMID 1647213 DOI:10.1016/0167-4781(91)90015-E
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Zhang Y., Gorry M.C., Post J.C., Ehrlich G.D. (1999). Genomic organization of the human fibroblast growth factor receptor 2 (FGFR2) gene and comparative analysis of the human FGFR gene family. Gene. 230: 69—79. PMID 10196476 DOI:10.1016/S0378-1119(99)00047-5
- Gray T.E., Eisenstein M., Yayon A., Givol D. (1996). Asparagine-344 is a key residue for ligand binding in keratinocyte growth factor receptor. Biochemistry. 35: 15640—15645. PMID 8961926 DOI:10.1021/bi961942c
- Lu Y., Pan Z.-Z., Devaux Y., Ray P. (2003). p21-activated protein kinase 4 (PAK4) interacts with the keratinocyte growth factor receptor and participates in keratinocyte growth factor-mediated inhibition of oxidant-induced cell death. J. Biol. Chem. 278: 10374—10380. PMID 12529371 DOI:10.1074/jbc.M205875200
- Kaabeche K., Lemonnier J., Le Mee S., Caverzasio J., Marie P.J. (2004). Cbl-mediated degradation of Lyn and Fyn induced by constitutive fibroblast growth factor receptor-2 activation supports osteoblast differentiation. J. Biol. Chem. 279: 36259—36267. PMID 15190072 DOI:10.1074/jbc.M402469200
Примітки
- Захворювання, генетично пов'язані з FGFR2 переглянути/редагувати посилання на ВікіДаних.
- Сполуки, які фізично взаємодіють з Fibroblast growth factor receptor 2 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:3689 (англ.) . Процитовано 8 вересня 2017.
- (англ.) . Архів оригіналу за 17 вересня 2017. Процитовано 8 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
FGFR2 angl Fibroblast growth factor receptor 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 10 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 821 aminokislot a molekulyarna masa 92 025 FGFR2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1DJS 1E0O 1EV2 1GJO 1II4 1IIL 1NUN 1OEC 1WVZ 2FDB 2PSQ 2PVF 2PVY 2PWL 2PY3 2PZ5 2PZP 2PZR 2Q0B 3B2T 3CAF 3CLY 3CU1 3DAR 3EUU 3OJ2 3OJM 3RI1 4J95 4J96 4J97 4J98 4J99 4J23 4WV1IdentifikatoriSimvoliFGFR2 BBDS BEK BFR 1 CD332 CEK3 CFD1 ECT1 JWS K SAM KGFR TK14 TK25 fibroblast growth factor receptor 2Zovnishni ID OMIM 176943 MGI 95523 HomoloGene 22566 GeneCards FGFR2Pov yazani genetichni zahvoryuvannyarak molochnoyi zalozi Crouzon syndrone Jackson Weiss syndrome Beare Stevenson cutis gyrata syndrome McGillivray syndrome LADD syndrome sindrom Antli Bikslera Kraniosinostoz Reaguye na spolukuNintedanib Nintedanib infigratinib brivanib erdafitinib lucitanib orantinib Ontologiya genaMolekulyarna funkciya heparin binding kinase activity transmembrane receptor protein tyrosine kinase activity fibroblast growth factor binding ATP binding protein kinase activity fibroblast growth factor activated receptor activity transferase activity protein homodimerization activity GO 0001948 GO 0016582 protein binding nucleotide binding protein tyrosine kinase activity 1 phosphatidylinositol 3 kinase activity phosphatidylinositol 4 5 bisphosphate 3 kinase activity identical protein binding receptor tyrosine kinase transmembrane signaling receptor activityKlitinna komponenta citoplazma membrana extracellular region klitinne yadro cell surface integral component of membrane kompleks Goldzhi vnutrishnoklitinna membranna organela GO 0005578 Pozaklitinna matricya klitinna membrana nukleoplazma cell cortex integral component of plasma membrane excitatory synapse GO 0016023 cytoplasmic vesicle receptor complex collagen containing extracellular matrixBiologichnij proces fibroblast growth factor receptor signaling pathway involved in orbitofrontal cortex development ureteric bud development organ growth limb bud formation embryonic pattern specification bud elongation involved in lung branching positive regulation of canonical Wnt signaling pathway membranous septum morphogenesis fibroblast growth factor receptor signaling pathway involved in positive regulation of cell proliferation in bone marrow embryonic organ morphogenesis post embryonic development squamous basal epithelial stem cell differentiation involved in prostate gland acinus development branching morphogenesis of a nerve reproductive structure development fibroblast growth factor receptor signaling pathway involved in negative regulation of apoptotic process in bone marrow cell ventricular cardiac muscle tissue morphogenesis protein phosphorylation positive regulation of cardiac muscle cell proliferation mesenchymal cell differentiation positive regulation of mesenchymal cell proliferation regulation of osteoblast differentiation prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis Angiogenez prostate gland morphogenesis positive regulation of ERK1 and ERK2 cascade orbitofrontal cortex development negative regulation of epithelial cell proliferation animal organ morphogenesis embryonic digestive tract morphogenesis hair follicle morphogenesis morphogenesis of embryonic epithelium branch elongation involved in salivary gland morphogenesis GO 0097285 apoptoz branching involved in salivary gland morphogenesis cell fate commitment lung development embryonic organ development fibroblast growth factor receptor signaling pathway involved in hemopoiesis in utero embryonic development lateral sprouting from an epithelium positive regulation of Wnt signaling pathway gland morphogenesis positive regulation of cell cycle branching involved in labyrinthine layer morphogenesis branching involved in prostate gland morphogenesis regulation of ERK1 and ERK2 cascade protein autophosphorylation mammary gland bud formation pyramidal neuron development lacrimal gland development positive regulation of MAPK cascade regulation of smooth muscle cell differentiation regulation of cell fate commitment bone mineralization regulation of branching involved in prostate gland morphogenesis positive regulation of epithelial cell proliferation involved in lung morphogenesis epithelial cell differentiation fosforilyuvannya multicellular organism growth positive regulation of epithelial cell proliferation ventricular zone neuroblast division epidermis morphogenesis skeletal system morphogenesis regulation of morphogenesis of a branching structure GO 1901227 negative regulation of transcription by RNA polymerase II outflow tract septum morphogenesis odontogenesis Epitelialno mezenhimalnij perehid lung alveolus development lung lobe morphogenesis midbrain development positive regulation of smooth muscle cell proliferation fibroblast growth factor receptor signaling pathway involved in mammary gland specification mesenchymal cell proliferation involved in lung development prostate epithelial cord elongation mesenchymal cell differentiation involved in lung development aksonogeneza regulation of multicellular organism growth otic vesicle formation epithelial cell proliferation involved in salivary gland morphogenesis cell cell signaling regulation of fibroblast growth factor receptor signaling pathway bone morphogenesis MAPK cascade regulation of osteoblast proliferation positive regulation of phospholipase activity fibroblast growth factor receptor signaling pathway regulation of smoothened signaling pathway inner ear morphogenesis positive regulation of cell population proliferation mesodermal cell differentiation peptidyl tyrosine phosphorylation digestive tract development lung associated mesenchyme development bone development positive regulation of cell division GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II phosphatidylinositol phosphate biosynthetic process phosphatidylinositol 3 phosphate biosynthetic process endochondral bone growth response to lipopolysaccharide Zagoyennya ran cellular response to fibroblast growth factor stimulus response to ethanol cellular response to retinoic acid cellular response to transforming growth factor beta stimulus embryonic cranial skeleton morphogenesis positive regulation of protein kinase B signaling negative regulation of signal transduction diferenciaciya klitin negative regulation of apoptotic process transmembrane receptor protein tyrosine kinase signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2263 14183Ensembl ENSG00000066468 ENSMUSG00000030849UniProt P21802 P21803RefSeq mRNK NM 000141 NM 001144913 NM 001144914 NM 001144915 NM 001144916NM 001144917 NM 001144918 NM 001144919 NM 022970 NM 022971 NM 022972 NM 022973 NM 022974 NM 022975 NM 022976 NM 023028 NM 023029 NM 023030 NM 001320654 NM 001320658 NM 023031NM 010207 NM 201601 NM 001347638RefSeq bilok NP 000132 NP 001138385 NP 001138386 NP 001138387 NP 001138388NP 001138389 NP 001138390 NP 001138391 NP 001307583 NP 001307587 NP 075259 NP 075418NP 001334567 NP 034337 NP 963895Lokus UCSC Hr 10 121 48 121 6 MbHr 7 129 76 132 73 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVY VAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPR DSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNN KRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQ EHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVE RSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSK YGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGI SFHSAWLTVLPAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRM KNTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTR LSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEA VGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINL LGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTF KDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARD INNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLG GSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTF KQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSP DPMPYEPCLPQYPHINGSVKT A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do transferaz kinaz receptoriv tirozinovih proteyinkinaz fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak apoptoz alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ATF nukleotidami z molekuloyu geparinu Lokalizovanij u klitinnij membrani membrani citoplazmatichnih vezikulah aparati goldzhi Takozh sekretovanij nazovni LiteraturaSeno M Sasada R Watanabe T Ishimaru K Igarashi K 1991 Two cDNAs encoding novel human FGF receptor Biochim Biophys Acta 1089 244 246 PMID 1647213 DOI 10 1016 0167 4781 91 90015 E The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Zhang Y Gorry M C Post J C Ehrlich G D 1999 Genomic organization of the human fibroblast growth factor receptor 2 FGFR2 gene and comparative analysis of the human FGFR gene family Gene 230 69 79 PMID 10196476 DOI 10 1016 S0378 1119 99 00047 5 Gray T E Eisenstein M Yayon A Givol D 1996 Asparagine 344 is a key residue for ligand binding in keratinocyte growth factor receptor Biochemistry 35 15640 15645 PMID 8961926 DOI 10 1021 bi961942c Lu Y Pan Z Z Devaux Y Ray P 2003 p21 activated protein kinase 4 PAK4 interacts with the keratinocyte growth factor receptor and participates in keratinocyte growth factor mediated inhibition of oxidant induced cell death J Biol Chem 278 10374 10380 PMID 12529371 DOI 10 1074 jbc M205875200 Kaabeche K Lemonnier J Le Mee S Caverzasio J Marie P J 2004 Cbl mediated degradation of Lyn and Fyn induced by constitutive fibroblast growth factor receptor 2 activation supports osteoblast differentiation J Biol Chem 279 36259 36267 PMID 15190072 DOI 10 1074 jbc M402469200PrimitkiZahvoryuvannya genetichno pov yazani z FGFR2 pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z Fibroblast growth factor receptor 2 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 3689 angl Procitovano 8 veresnya 2017 angl Arhiv originalu za 17 veresnya 2017 Procitovano 8 veresnya 2017 Div takozhHromosoma 10 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi