Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

FGF2 англ Fibroblast growth factor 2 білок який кодується однойменним геном розташованим у людей на короткому плечі 4 ї

FGF2

FGF2

FGF2 (англ. Fibroblast growth factor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. Довжина поліпептидного ланцюга білка становить 288 амінокислот, а молекулярна маса — 30 770.

FGF2
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи FGF2, BFGF, FGF-2, FGFB, HBGF-2, fibroblast growth factor 2
Зовнішні ІД OMIM: 134920 MGI: 95516 HomoloGene: 1521 GeneCards: FGF2
Шаблон експресії
image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
2247
14173
Ensembl
ENSG00000138685
ENSMUSG00000037225
UniProt
P09038
P15655
RefSeq (мРНК)
NM_002006
NM_001361665
NM_008006
RefSeq (білок)
NP_001997
NP_001348594
NP_032032
Локус (UCSC) Хр. 4: 122.83 – 122.9 Mb Хр. 3: 37.4 – 37.46 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRH
PSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGR
APERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGG
SGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAE
ERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRS
RKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Кодований геном білок за функціями належить до факторів росту, мітогенів, , фосфопротеїнів. Задіяний у таких біологічних процесах як ангіогенез, диференціація. Білок має сайт для зв'язування з молекулою гепарину. Локалізований у ядрі. Також секретований назовні.

Рекомбінантний людський FGF2 (трафермін) є лікарським засобом, що використовується для лікування виразок та опіків.

Література

  • Kurokawa T., Sasada R., Iwane M., Igarashi K. (1987). Cloning and expression of cDNA encoding human basic fibroblast growth factor. FEBS Lett. 213: 189—194. PMID 2435575 DOI:10.1016/0014-5793(87)81489-8
  • Gimenez-Gallego G., Conn G., Hatcher V.B., Thomas K.A. (1986). Human brain-derived acidic and basic fibroblast growth factors: amino terminal sequences and specific mitogenic activities. Biochem. Biophys. Res. Commun. 135: 541—548. PMID 3964259 DOI:10.1016/0006-291X(86)90028-8
  • Gautschi P., Frater-Schroeder M., Boehlen P. (1986). Partial molecular characterization of endothelial cell mitogens from human brain: acidic and basic fibroblast growth factors. FEBS Lett. 204: 203—207. PMID 3732516 DOI:10.1016/0014-5793(86)80812-2
  • Goretzki L., Burg M.A., Grako K.A., Stallcup W.B. (1999). High-affinity binding of basic fibroblast growth factor and platelet-derived growth factor-AA to the core protein of the NG2 proteoglycan. J. Biol. Chem. 274: 16831—16837. PMID 10358027 DOI:10.1074/jbc.274.24.16831
  • Skjerpen C.S., Wesche J., Olsnes S. (2002). Identification of ribosome-binding protein p34 as an intracellular protein that binds acidic fibroblast growth factor. J. Biol. Chem. 277: 23864—23871. PMID 11964394 DOI:10.1074/jbc.M112193200
  • Eswarakumar V.P., Lax I., Schlessinger J. (2005). Cellular signaling by fibroblast growth factor receptors. Cytokine Growth Factor Rev. 16: 139—149. PMID 15863030 DOI:10.1016/j.cytogfr.2005.01.001

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:3676 (англ.) . Процитовано 30 серпня 2017.
  4. (англ.) . Архів оригіналу за 20 серпня 2017. Процитовано 30 серпня 2017.

Див. також


image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

FGF2 angl Fibroblast growth factor 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 4 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 288 aminokislot a molekulyarna masa 30 770 FGF2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1BAS 1BFB 1BFC 1BFF 1BFG 1BLA 1BLD 1CVS 1EV2 1FGA 1FQ9 1II4 1IIL 2BFH 2FGF 2M49 4FGF 4OEE 4OEF 4OEGIdentifikatoriSimvoliFGF2 BFGF FGF 2 FGFB HBGF 2 fibroblast growth factor 2Zovnishni ID OMIM 134920 MGI 95516 HomoloGene 1521 GeneCards FGF2Ontologiya genaMolekulyarna funkciya cytokine activity heparin binding fibroblast growth factor receptor binding GO 0001948 GO 0016582 protein binding nuclear receptor coactivator activity chemoattractant activity growth factor activity protein tyrosine kinase activity phosphatidylinositol 4 5 bisphosphate 3 kinase activity 1 phosphatidylinositol 3 kinase activity receptor receptor interaction integrin bindingKlitinna komponenta extracellular region klitinne yadro mizhklitinnij prostirBiologichnij proces release of sequestered calcium ion into cytosol diferenciaciya klitin negative regulation of fibroblast migration hyaluronan catabolic process positive regulation of endothelial cell proliferation positive regulation of MAP kinase activity negative regulation of blood vessel endothelial cell migration positive regulation of endothelial cell chemotaxis to fibroblast growth factor somatic stem cell population maintenance positive regulation of phospholipase C activity extracellular matrix organization Zagoyennya ran negative regulation of cell death regulation of angiogenesis nejrobiologiya rozvitku cell migration involved in sprouting angiogenesis MAPK cascade positive regulation of angiogenesis positive regulation of phosphatidylinositol 3 kinase activity GO 0060469 GO 0009371 positive regulation of transcription DNA templated hemotaksis fibroblast growth factor receptor signaling pathway chondroblast differentiation multicellular organism development growth factor dependent regulation of skeletal muscle satellite cell proliferation branching involved in ureteric bud morphogenesis positive regulation of cardiac muscle cell proliferation embryonic morphogenesis Angiogenez positive regulation of cell fate specification animal organ morphogenesis regulation of endothelial cell chemotaxis to fibroblast growth factor phosphatidylinositol biosynthetic process inositol phosphate biosynthetic process negative regulation of wound healing Ras protein signal transduction positive regulation of cell division GO 0072468 signalna transdukciya GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II positive chemotaxis phosphatidylinositol phosphate biosynthetic process peptidyl tyrosine phosphorylation positive regulation of sprouting angiogenesis positive regulation of cell population proliferation phosphatidylinositol 3 phosphate biosynthetic process stem cell proliferation regulation of signaling receptor activity positive regulation of protein kinase B signaling cytokine mediated signaling pathway positive regulation of blood vessel endothelial cell migration positive regulation of ERK1 and ERK2 cascade positive regulation of vascular associated smooth muscle cell proliferation positive regulation of vascular endothelial cell proliferation positive regulation of cell migration involved in sprouting angiogenesis paracrine signaling positive regulation of DNA biosynthetic process positive regulation of endothelial cell chemotaxisDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2247 14173Ensembl ENSG00000138685 ENSMUSG00000037225UniProt P09038 P15655RefSeq mRNK NM 002006 NM 001361665NM 008006RefSeq bilok NP 001997 NP 001348594NP 032032Lokus UCSC Hr 4 122 83 122 9 MbHr 3 37 4 37 46 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKSA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do faktoriv rostu mitogeniv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak angiogenez diferenciaciya Bilok maye sajt dlya zv yazuvannya z molekuloyu geparinu Lokalizovanij u yadri Takozh sekretovanij nazovni Rekombinantnij lyudskij FGF2 trafermin ye likarskim zasobom sho vikoristovuyetsya dlya likuvannya virazok ta opikiv LiteraturaKurokawa T Sasada R Iwane M Igarashi K 1987 Cloning and expression of cDNA encoding human basic fibroblast growth factor FEBS Lett 213 189 194 PMID 2435575 DOI 10 1016 0014 5793 87 81489 8 Gimenez Gallego G Conn G Hatcher V B Thomas K A 1986 Human brain derived acidic and basic fibroblast growth factors amino terminal sequences and specific mitogenic activities Biochem Biophys Res Commun 135 541 548 PMID 3964259 DOI 10 1016 0006 291X 86 90028 8 Gautschi P Frater Schroeder M Boehlen P 1986 Partial molecular characterization of endothelial cell mitogens from human brain acidic and basic fibroblast growth factors FEBS Lett 204 203 207 PMID 3732516 DOI 10 1016 0014 5793 86 80812 2 Goretzki L Burg M A Grako K A Stallcup W B 1999 High affinity binding of basic fibroblast growth factor and platelet derived growth factor AA to the core protein of the NG2 proteoglycan J Biol Chem 274 16831 16837 PMID 10358027 DOI 10 1074 jbc 274 24 16831 Skjerpen C S Wesche J Olsnes S 2002 Identification of ribosome binding protein p34 as an intracellular protein that binds acidic fibroblast growth factor J Biol Chem 277 23864 23871 PMID 11964394 DOI 10 1074 jbc M112193200 Eswarakumar V P Lax I Schlessinger J 2005 Cellular signaling by fibroblast growth factor receptors Cytokine Growth Factor Rev 16 139 149 PMID 15863030 DOI 10 1016 j cytogfr 2005 01 001PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 3676 angl Procitovano 30 serpnya 2017 angl Arhiv originalu za 20 serpnya 2017 Procitovano 30 serpnya 2017 Div takozhHromosoma 4 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ