F7 (англ. Coagulation factor VII, Проконвертин) — білок, який кодується однойменним геном, розташованим у людей на короткому плечі 13-ї хромосоми. Довжина поліпептидного ланцюга білка становить 466 амінокислот, а молекулярна маса — 51 594.
F7 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | F7, SPCA, coagulation factor VII | ||||||||||||||||
Зовнішні ІД | OMIM: 613878 MGI: 109325 HomoloGene: 7710 GeneCards: F7 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
factor VII deficiency | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 13: 113.11 – 113.12 Mb | Хр. 8: 13.08 – 13.09 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MVSQALRLLC | LLLGLQGCLA | AGGVAKASGG | ETRDMPWKPG | PHRVFVTQEE | ||||
AHGVLHRRRR | ANAFLEELRP | GSLERECKEE | QCSFEEAREI | FKDAERTKLF | ||||
WISYSDGDQC | ASSPCQNGGS | CKDQLQSYIC | FCLPAFEGRN | CETHKDDQLI | ||||
CVNENGGCEQ | YCSDHTGTKR | SCRCHEGYSL | LADGVSCTPT | VEYPCGKIPI | ||||
LEKRNASKPQ | GRIVGGKVCP | KGECPWQVLL | LVNGAQLCGG | TLINTIWVVS | ||||
AAHCFDKIKN | WRNLIAVLGE | HDLSEHDGDE | QSRRVAQVII | PSTYVPGTTN | ||||
HDIALLRLHQ | PVVLTDHVVP | LCLPERTFSE | RTLAFVRFSL | VSGWGQLLDR | ||||
GATALELMVL | NVPRLMTQDC | LQQSRKVGDS | PNITEYMFCA | GYSDGSKDSC | ||||
KGDSGGPHAT | HYRGTWYLTG | IVSWGQGCAT | VGHFGVYTRV | SQYIEWLQKL | ||||
MRSEPRPGVL | LRAPFP |
Кодований геном білок за функціями належить до гідролаз, протеаз, серинових протеаз. Задіяний у таких біологічних процесах, як зсідання крові, гемостаз, альтернативний сплайсинг. Білок має сайт для зв'язування з іоном кальцію. Секретований назовні.
Див. також
Примітки
- Захворювання, генетично пов'язані з F7 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:3544 (англ.) . Процитовано 11 вересня 2017.
- (англ.) . Архів оригіналу за 17 вересня 2017. Процитовано 11 вересня 2017.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Wang Y., Lee G.F., Kelley R.F., Spellman M.W. (1996). Identification of a GDP-L-fucose:polypeptide fucosyltransferase and enzymatic addition of O-linked fucose to EGF domains. Glycobiology. 6: 837—842. PMID 9023546 DOI:10.1093/glycob/6.8.837
- Ruiz-Canada C., Kelleher D.J., Gilmore R. (2009). Cotranslational and posttranslational N-glycosylation of polypeptides by distinct mammalian OST isoforms. Cell. 136: 272—283. PMID 19167329 DOI:10.1016/j.cell.2008.11.047
- Zhang E., St Charles R., Tulinsky A. (1999). Structure of extracellular tissue factor complexed with factor VIIa inhibited with a BPTI mutant. J. Mol. Biol. 285: 2089—2104. PMID 9925787 DOI:10.1006/jmbi.1998.2452
- Marchetti G., Ferrati M., Patracchini P., Redaelli R., Bernardi F. (1993). A missense mutation (178Cys-->Tyr) and two neutral dimorphisms (115His and 333Ser) in the human coagulation factor VII gene. Hum. Mol. Genet. 2: 1055—1056. PMID 8364544 DOI:10.1093/hmg/2.7.1055
- Dewald G., Noethen M.M., Ruther K. (1994). A common Ser/Thr polymorphism in the perforin-homologous region of human complement component C7. Hum. Hered. 44: 301—304. PMID 7860081 DOI:10.1159/000154235
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
F7 angl Coagulation factor VII Prokonvertin bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 13 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 466 aminokislot a molekulyarna masa 51 594 F7Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB4YT7 1BF9 1CVW 1DAN 1DVA 1F7E 1F7M 1FAK 1FF7 1FFM 1J9C 1JBU 1KLI 1KLJ 1O5D 1QFK 1W0Y 1W2K 1W7X 1W8B 1WQV 1WSS 1WTG 1WUN 1WV7 1YGC 1Z6J 2A2Q 2AEI 2AER 2B7D 2B8O 2BZ6 2C4F 2EC9 2F9B 2FIR 2FLB 2FLR 2PUQ 2ZP0 2ZWL 2ZZU 3ELA 3TH2 3TH3 3TH4 4IBL 4ISH 4ISI 4JYU 4JYV 4JZD 4JZE 4JZF 4NA9 4NG9 4NGA 4X8S 4X8T 4X8U 4X8V 4YT6 4ZXX 4ZXY 4Z6A 4ZMA 4YLQ 5I46IdentifikatoriSimvoliF7 SPCA coagulation factor VIIZovnishni ID OMIM 613878 MGI 109325 HomoloGene 7710 GeneCards F7Pov yazani genetichni zahvoryuvannyafactor VII deficiency Ontologiya genaMolekulyarna funkciya calcium ion binding endopeptidase activity GO 0070122 peptidase activity GO 0001948 GO 0016582 protein binding serine type peptidase activity hydrolase activity serine type endopeptidase activity signaling receptor bindingKlitinna komponenta vezikula endoplasmic reticulum lumen klitinna membrana extracellular region Golgi lumen mizhklitinnij prostir serine type peptidase complex collagen containing extracellular matrixBiologichnij proces gemostaz positive regulation of protein kinase B signaling GO 1904578 response to organic cyclic compound positive regulation of cell migration positive regulation of platelet derived growth factor receptor signaling pathway proteoliz response to estrogen positive regulation of leukocyte chemotaxis endoplasmic reticulum to Golgi vesicle mediated transport response to vitamin K positive regulation of blood coagulation response to nutrient levels animal organ regeneration response to growth hormone response to hormone blood coagulation extrinsic pathway positive regulation of positive chemotaxis response to thyroid hormone protein processing zsidannya krovi response to 2 3 7 8 tetrachlorodibenzodioxine response to estradiol response to carbon dioxide response to genistein response to cholesterol cirkadnij ritm response to thyroxine response to Thyroid stimulating hormone response to hypoxia response to anticoagulant response to astaxanthin response to thyrotropin releasing hormoneDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2155 14068Ensembl ENSG00000057593 ENSMUSG00000031443UniProt P08709 P70375RefSeq mRNK NM 000131 NM 001267554 NM 019616NM 010172RefSeq bilok NP 000122 NP 001254483 NP 062562NP 034302Lokus UCSC Hr 13 113 11 113 12 MbHr 8 13 08 13 09 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MVSQALRLLCLLLGLQGCLAAGGVAKASGGETRDMPWKPGPHRVFVTQEE AHGVLHRRRRANAFLEELRPGSLERECKEEQCSFEEAREIFKDAERTKLF WISYSDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDQLI CVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPI LEKRNASKPQGRIVGGKVCPKGECPWQVLLLVNGAQLCGGTLINTIWVVS AAHCFDKIKNWRNLIAVLGEHDLSEHDGDEQSRRVAQVIIPSTYVPGTTN HDIALLRLHQPVVLTDHVVPLCLPERTFSERTLAFVRFSLVSGWGQLLDR GATALELMVLNVPRLMTQDCLQQSRKVGDSPNITEYMFCAGYSDGSKDSC KGDSGGPHATHYRGTWYLTGIVSWGQGCATVGHFGVYTRVSQYIEWLQKL MRSEPRPGVLLRAPFP A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do gidrolaz proteaz serinovih proteaz Zadiyanij u takih biologichnih procesah yak zsidannya krovi gemostaz alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ionom kalciyu Sekretovanij nazovni Div takozhHromosoma 13 Zsidannya kroviPrimitkiZahvoryuvannya genetichno pov yazani z F7 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 3544 angl Procitovano 11 veresnya 2017 angl Arhiv originalu za 17 veresnya 2017 Procitovano 11 veresnya 2017 LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Wang Y Lee G F Kelley R F Spellman M W 1996 Identification of a GDP L fucose polypeptide fucosyltransferase and enzymatic addition of O linked fucose to EGF domains Glycobiology 6 837 842 PMID 9023546 DOI 10 1093 glycob 6 8 837 Ruiz Canada C Kelleher D J Gilmore R 2009 Cotranslational and posttranslational N glycosylation of polypeptides by distinct mammalian OST isoforms Cell 136 272 283 PMID 19167329 DOI 10 1016 j cell 2008 11 047 Zhang E St Charles R Tulinsky A 1999 Structure of extracellular tissue factor complexed with factor VIIa inhibited with a BPTI mutant J Mol Biol 285 2089 2104 PMID 9925787 DOI 10 1006 jmbi 1998 2452 Marchetti G Ferrati M Patracchini P Redaelli R Bernardi F 1993 A missense mutation 178Cys gt Tyr and two neutral dimorphisms 115His and 333Ser in the human coagulation factor VII gene Hum Mol Genet 2 1055 1056 PMID 8364544 DOI 10 1093 hmg 2 7 1055 Dewald G Noethen M M Ruther K 1994 A common Ser Thr polymorphism in the perforin homologous region of human complement component C7 Hum Hered 44 301 304 PMID 7860081 DOI 10 1159 000154235 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi