Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
Мітоген-активована протеїнкіназа 1 (англ. Mitogen-activated protein kinase 1) – білок, який кодується геном MAPK1, розташованим у людей на короткому плечі 22-ї хромосоми. Довжина поліпептидного ланцюга білка становить 360 амінокислот, а молекулярна маса — 41 390.
| Мітоген-активована протеїнкіназа 1 | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
 | |||||||||||||||||
| |||||||||||||||||
| Ідентифікатори | |||||||||||||||||
| Символи | MAPK1, ERK, ERK-2, ERK2, ERT1, MAPK2, P42MAPK, PRKM1, PRKM2, p38, p40, p41, p41mapk, p42-MAPK, mitogen-activated protein kinase 1, NS13 | ||||||||||||||||
| Зовнішні ІД | OMIM: 176948 MGI: 1346858 HomoloGene: 37670 GeneCards: MAPK1 | ||||||||||||||||
| Пов'язані генетичні захворювання | |||||||||||||||||
| розсіяний склероз | |||||||||||||||||
| Реагує на сполуку | |||||||||||||||||
| ravoxertinib, ulixertinib | |||||||||||||||||
| |||||||||||||||||
| Шаблон експресії | |||||||||||||||||
  | |||||||||||||||||
| Більше даних | |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 22: 21.76 – 21.87 Mb | Хр. 16: 16.8 – 16.87 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MAAAAAAGAG | PEMVRGQVFD | VGPRYTNLSY | IGEGAYGMVC | SAYDNVNKVR | ||||
| VAIKKISPFE | HQTYCQRTLR | EIKILLRFRH | ENIIGINDII | RAPTIEQMKD | ||||
| VYIVQDLMET | DLYKLLKTQH | LSNDHICYFL | YQILRGLKYI | HSANVLHRDL | ||||
| KPSNLLLNTT | CDLKICDFGL | ARVADPDHDH | TGFLTEYVAT | RWYRAPEIML | ||||
| NSKGYTKSID | IWSVGCILAE | MLSNRPIFPG | KHYLDQLNHI | LGILGSPSQE | ||||
| DLNCIINLKA | RNYLLSLPHK | NKVPWNRLFP | NADSKALDLL | DKMLTFNPHK | ||||
| RIEVEQALAH | PYLEQYYDPS | DEPIAEAPFK | FDMELDDLPK | EKLKELIFEE | ||||
| TARFQPGYRS |
Цей білок за функціями належить до трансфераз, репресорів, кіназ, серин/треонінових протеїнкіназ. Задіяний у таких біологічних процесах як апоптоз, взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, клітинний цикл. Білок має сайт для зв'язування з АТФ, нуклеотидами, ДНК. Локалізований у цитоплазмі, цитоскелеті, ядрі.
Література
- Owaki H., Makar R., Boulton T.G., Cobb M.H., Geppert T.D. (1992). Extracellular signal-regulated kinases in T cells: characterization of human ERK1 and ERK2 cDNAs. Biochem. Biophys. Res. Commun. 182: 1416—1422. PMID 1540184 DOI:10.1016/0006-291X(92)91891-S
- Gonzalez F.A., Raden D.L., Rigby M.R., Davis R.J. (1992). Heterogeneous expression of four MAP kinase isoforms in human tissues. FEBS Lett. 304: 170—178. PMID 1319925 DOI:10.1016/0014-5793(92)80612-K
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Ni H., Wang X.S., Diener K., Yao Z. (1998). MAPKAPK5, a novel mitogen-activated protein kinase (MAPK)-activated protein kinase, is a substrate of the extracellular-regulated kinase (ERK) and p38 kinase. Biochem. Biophys. Res. Commun. 243: 492—496. PMID 9480836 DOI:10.1006/bbrc.1998.8135
- Deak M., Clifton A.D., Lucocq J.M., Alessi D.R. (1998). Mitogen- and stress-activated protein kinase-1 (MSK1) is directly activated by MAPK and SAPK2/p38, and may mediate activation of CREB. EMBO J. 17: 4426—4441. PMID 9687510 DOI:10.1093/emboj/17.15.4426
- Niu H., Ye B.H., Dalla-Favera R. (1998). Antigen receptor signaling induces MAP kinase-mediated phosphorylation and degradation of the BCL-6 transcription factor. Genes Dev. 12: 1953—1961. PMID 9649500 DOI:10.1101/gad.12.13.1953
Примітки
- Захворювання, генетично пов'язані з Мітоген-активована протеїнкіназа 1 переглянути/редагувати посилання на ВікіДаних.
- Сполуки, які фізично взаємодіють з mitogen-activated protein kinase 1 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 18 квітня 2017. Процитовано 27 лютого 2017.
- (англ.) . Архів оригіналу за 6 лютого 2017. Процитовано 27 лютого 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
Mitogen aktivovana proteyinkinaza 1 angl Mitogen activated protein kinase 1 bilok yakij koduyetsya genom MAPK1 roztashovanim u lyudej na korotkomu plechi 22 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 360 aminokislot a molekulyarna masa 41 390 Mitogen aktivovana proteyinkinaza 1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1PME 1TVO 1WZY 2OJG 2OJI 2OJJ 2Y9Q 3D42 3D44 3I5Z 3I60 3SA0 3TEI 3W55 4FMQ 4FUX 4FUY 4FV0 4FV1 4FV2 4FV3 4FV4 4FV5 4FV6 4FV7 4FV8 4FV9 4G6N 4G6O 4H3P 4H3Q 4IZ5 4IZ7 4IZA 4N0S 4NIF 4O6E 4QTA 4QTE 4ZZM 4ZZN 4ZZO 5BUE 5BUI 5BUJ 4QP1 4QP2 4QP3 4QP4 4QP6 4QP7 4QP8 4QP9 4QPA 4XJ0 5BVD 5BVE 5BVF 5AX3 4ZXT 5K4IIdentifikatoriSimvoliMAPK1 ERK ERK 2 ERK2 ERT1 MAPK2 P42MAPK PRKM1 PRKM2 p38 p40 p41 p41mapk p42 MAPK mitogen activated protein kinase 1 NS13Zovnishni ID OMIM 176948 MGI 1346858 HomoloGene 37670 GeneCards MAPK1Pov yazani genetichni zahvoryuvannyarozsiyanij sklerozReaguye na spolukuravoxertinib ulixertinibOntologiya genaMolekulyarna funkciya phosphatase binding ATP binding protein kinase activity transcription factor binding transferase activity mitogen activated protein kinase kinase kinase binding phosphotyrosine residue binding GO 0001948 GO 0016582 protein binding protein kinase binding DNA binding nucleotide binding RNA polymerase II CTD heptapeptide repeat kinase activity protein serine threonine kinase activity kinase activity identical protein binding MAP kinase activity double stranded DNA binding MAP kinase kinase activityKlitinna komponenta citoplazma gialoplazma focal adhesion centr organizaciyi mikrotrubochok mitohondriya caveola dendrite cytoplasm citoskelet klitinne yadro ekzosoma perikarion late endosome kompleks Goldzhi vereteno podilu akson early endosome mitotic spindle Psevdopodiya extracellular region nukleoplazma azurophil granule lumen ficolin 1 rich granule lumen klitinna membrana GO 0097483 GO 0097481 postsinaptichne ushilnennya membrana GO 0009327 protein containing complexBiologichnij proces caveolin mediated endocytosis positive regulation of telomere capping response to exogenous dsRNA cardiac neural crest cell development involved in heart development positive regulation of translation cellular response to DNA damage stimulus platelet activation Fc epsilon receptor signaling pathway protein phosphorylation face development cellular response to granulocyte macrophage colony stimulating factor stimulus regulation of DNA binding transcription factor activity animal organ morphogenesis klitinnij cikl ERBB signaling pathway GO 0097285 apoptoz B cell receptor signaling pathway GO 0009373 regulation of transcription DNA templated regulation of protein stability Fc gamma receptor signaling pathway involved in phagocytosis thymus development negative regulation of cell differentiation ERK1 and ERK2 cascade labyrinthine layer blood vessel development transcription DNA templated GO 0060469 GO 0009371 positive regulation of transcription DNA templated heart development GO 0022415 viral process response to toxic substance regulation of stress activated MAPK cascade chemical synaptic transmission growth hormone receptor signaling pathway via JAK STAT cytosine metabolic process fosforilyuvannya outer ear morphogenesis response to estrogen hemotaksis response to lipopolysaccharide thyroid gland development response to epidermal growth factor positive regulation of telomerase activity sensory perception of pain peptidyl threonine phosphorylation trachea formation lipopolysaccharide mediated signaling pathway mammary gland epithelial cell proliferation GO 0007243 intracellular signal transduction lung morphogenesis neural crest cell development positive regulation of cell migration regulation of early endosome to late endosome transport response to stress positive regulation of telomere maintenance via telomerase MAPK cascade axon guidance fibroblast growth factor receptor signaling pathway positive regulation of peptidyl threonine phosphorylation GO 0035404 peptidyl serine phosphorylation positive regulation of cell population proliferation regulation of cellular response to heat Bergmann glial cell differentiation regulation of Golgi inheritance T cell receptor signaling pathway regulation of cytoskeleton organization GO 0072468 signalna transdukciya dovgotrivala potenciaciya regulation of ossification regulation of phosphatidylinositol 3 kinase signaling neutrophil degranulation regulyaciya ekspresiyi geniv cellular response to organic substance GO 0010260 starinnya lyudini learning or memory GO 1901313 positive regulation of gene expression diadenosine tetraphosphate biosynthetic process regulation of cellular pH cellular response to amino acid starvation GO 0072353 cellular response to reactive oxygen species response to nicotine decidualization stress activated MAPK cascade positive regulation of cardiac muscle cell proliferation cellular response to cadmium ion cellular response to tumor necrosis factor cellular response to dopamine positive regulation of protein import into nucleusDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5594 26413Ensembl ENSG00000100030 ENSMUSG00000063358UniProt P28482 P63085RefSeq mRNK NM 138957 NM 002745NM 001038663 NM 011949 NM 001357115 NM 028991RefSeq bilok NP 002736 NP 620407NP 001033752 NP 036079 NP 001344044Lokus UCSC Hr 22 21 76 21 87 MbHr 16 16 8 16 87 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRSA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Cej bilok za funkciyami nalezhit do transferaz represoriv kinaz serin treoninovih proteyinkinaz Zadiyanij u takih biologichnih procesah yak apoptoz vzayemodiya hazyayin virus transkripciya regulyaciya transkripciyi klitinnij cikl Bilok maye sajt dlya zv yazuvannya z ATF nukleotidami DNK Lokalizovanij u citoplazmi citoskeleti yadri LiteraturaOwaki H Makar R Boulton T G Cobb M H Geppert T D 1992 Extracellular signal regulated kinases in T cells characterization of human ERK1 and ERK2 cDNAs Biochem Biophys Res Commun 182 1416 1422 PMID 1540184 DOI 10 1016 0006 291X 92 91891 S Gonzalez F A Raden D L Rigby M R Davis R J 1992 Heterogeneous expression of four MAP kinase isoforms in human tissues FEBS Lett 304 170 178 PMID 1319925 DOI 10 1016 0014 5793 92 80612 K The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Ni H Wang X S Diener K Yao Z 1998 MAPKAPK5 a novel mitogen activated protein kinase MAPK activated protein kinase is a substrate of the extracellular regulated kinase ERK and p38 kinase Biochem Biophys Res Commun 243 492 496 PMID 9480836 DOI 10 1006 bbrc 1998 8135 Deak M Clifton A D Lucocq J M Alessi D R 1998 Mitogen and stress activated protein kinase 1 MSK1 is directly activated by MAPK and SAPK2 p38 and may mediate activation of CREB EMBO J 17 4426 4441 PMID 9687510 DOI 10 1093 emboj 17 15 4426 Niu H Ye B H Dalla Favera R 1998 Antigen receptor signaling induces MAP kinase mediated phosphorylation and degradation of the BCL 6 transcription factor Genes Dev 12 1953 1961 PMID 9649500 DOI 10 1101 gad 12 13 1953PrimitkiZahvoryuvannya genetichno pov yazani z Mitogen aktivovana proteyinkinaza 1 pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z mitogen activated protein kinase 1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 18 kvitnya 2017 Procitovano 27 lyutogo 2017 angl Arhiv originalu za 6 lyutogo 2017 Procitovano 27 lyutogo 2017 Div takozhHromosoma 22Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi