BOK (англ. BOK, BCL2 family apoptosis regulator) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. Довжина поліпептидного ланцюга білка становить 212 амінокислот, а молекулярна маса — 23 280.
BOK | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Ідентифікатори | |||||||||||||||||
Символи | BOK, BCL2L9, BOKL, BCL2-related ovarian killer, BCL2 family apoptosis regulator, BCL2 family apoptosis regulator BOK | ||||||||||||||||
Зовнішні ІД | OMIM: 605404 MGI: 1858494 HomoloGene: 9632 GeneCards: BOK | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 2: 241.55 – 241.57 Mb | Хр. 1: 93.61 – 93.62 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MEVLRRSSVF | AAEIMDAFDR | SPTDKELVAQ | AKALGREYVH | ARLLRAGLSW | ||||
SAPERAAPVP | GRLAEVCAVL | LRLGDELEMI | RPSVYRNVAR | QLHISLQSEP | ||||
VVTDAFLAVA | GHIFSAGITW | GKVVSLYAVA | AGLAVDCVRQ | AQPAMVHALV | ||||
DCLGEFVRKT | LATWLRRRGG | WTDVLKCVVS | TDPGLRSHWL | VAALCSFGRF | ||||
LKAAFFVLLP | ER |
Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як апоптоз, альтернативний сплайсинг. Локалізований у цитоплазмі, ядрі, мембрані, мітохондрії, внутрішній мембрані мітохондрії, ендоплазматичному ретикулумі, зовнішній мембрані мітохондрій, апараті гольджі, ендосомах.
Література
- Zhang H., Holzgreve W., De Geyter C. (2000). Evolutionarily conserved Bok proteins in the Bcl-2 family. FEBS Lett. 480: 311—313. PMID 11034351 DOI:10.1016/S0014-5793(00)01921-9
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Gao S., Fu W., Duerrenberger M., De Geyter C., Zhang H. (2005). Membrane translocation and oligomerization of hBok are triggered in response to apoptotic stimuli and Bnip3. Cell. Mol. Life Sci. 62: 1015—1024. PMID 15868100 DOI:10.1007/s00018-005-4543-3
- Ray J.E., Garcia J., Jurisicova A., Caniggia I. (2010). Mtd/Bok takes a swing: proapoptotic Mtd/Bok regulates trophoblast cell proliferation during human placental development and in preeclampsia. Cell Death Differ. 17: 846—859. PMID 19942931 DOI:10.1038/cdd.2009.167
- Schulman J.J., Wright F.A., Kaufmann T., Wojcikiewicz R.J. (2013). The Bcl-2 protein family member Bok binds to the coupling domain of inositol 1,4,5-trisphosphate receptors and protects them from proteolytic cleavage. J. Biol. Chem. 288: 25340—25349. PMID 23884412 DOI:10.1074/jbc.M113.496570
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 16 липня 2017. Процитовано 28 серпня 2017.
- (англ.) . Архів оригіналу за 19 липня 2017. Процитовано 28 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
BOK angl BOK BCL2 family apoptosis regulator bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 2 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 212 aminokislot a molekulyarna masa 23 280 BOKIdentifikatoriSimvoliBOK BCL2L9 BOKL BCL2 related ovarian killer BCL2 family apoptosis regulator BCL2 family apoptosis regulator BOKZovnishni ID OMIM 605404 MGI 1858494 HomoloGene 9632 GeneCards BOKOntologiya genaMolekulyarna funkciya protein dimerization activity GO 0001948 GO 0016582 protein binding signaling receptor binding ubiquitin protein ligase binding protein homodimerization activity protein heterodimerization activity BH domain bindingKlitinna komponenta integral component of membrane mitohondriya klitinne yadro nuclear outer membrane citoplazma mitohondrialna vnutrishnya membrana endosoma endoplazmatichnij retikulum endoplasmic reticulum membrane kompleks Goldzhi membrana early endosome membrane mitohondrialna membrana trans Golgi network membrane cis Golgi network membrane recycling endosome membrane mitohondrialna zovnishnya membranaBiologichnij proces regulation of apoptotic process neuron apoptotic process male gonad development positive regulation of execution phase of apoptosis oligodendrocyte differentiation brain development intrinsic apoptotic signaling pathway by p53 class mediator proliferaciya activation of cysteine type endopeptidase activity involved in apoptotic process GO 0097285 apoptoz release of cytochrome c from mitochondria cellular component disassembly involved in execution phase of apoptosis activation of cysteine type endopeptidase activity involved in apoptotic process by cytochrome c regulation of autophagy positive regulation of apoptotic process GO 1904089 negative regulation of neuron apoptotic process protein complex oligomerization regulation of cytosolic calcium ion concentration negative regulation of mitochondrial depolarization negative regulation of necroptotic process negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway regulation of chorionic trophoblast cell proliferation positive regulation of endoplasmic reticulum stress induced intrinsic apoptotic signaling pathway positive regulation of PERK mediated unfolded protein response regulation of granulosa cell apoptotic process positive regulation of intrinsic apoptotic signaling pathway intrinsic apoptotic signaling pathway in response to DNA damage extrinsic apoptotic signaling pathway in absence of ligandDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez666 51800Ensembl ENSG00000176720 ENSMUSG00000026278UniProt Q9UMX3 O35425RefSeq mRNK NM 032515NM 016778RefSeq bilok NP 115904NP 058058Lokus UCSC Hr 2 241 55 241 57 MbHr 1 93 61 93 62 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSW SAPERAAPVPGRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEP VVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALV DCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRF LKAAFFVLLPER A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak apoptoz alternativnij splajsing Lokalizovanij u citoplazmi yadri membrani mitohondriyi vnutrishnij membrani mitohondriyi endoplazmatichnomu retikulumi zovnishnij membrani mitohondrij aparati goldzhi endosomah LiteraturaZhang H Holzgreve W De Geyter C 2000 Evolutionarily conserved Bok proteins in the Bcl 2 family FEBS Lett 480 311 313 PMID 11034351 DOI 10 1016 S0014 5793 00 01921 9 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Gao S Fu W Duerrenberger M De Geyter C Zhang H 2005 Membrane translocation and oligomerization of hBok are triggered in response to apoptotic stimuli and Bnip3 Cell Mol Life Sci 62 1015 1024 PMID 15868100 DOI 10 1007 s00018 005 4543 3 Ray J E Garcia J Jurisicova A Caniggia I 2010 Mtd Bok takes a swing proapoptotic Mtd Bok regulates trophoblast cell proliferation during human placental development and in preeclampsia Cell Death Differ 17 846 859 PMID 19942931 DOI 10 1038 cdd 2009 167 Schulman J J Wright F A Kaufmann T Wojcikiewicz R J 2013 The Bcl 2 protein family member Bok binds to the coupling domain of inositol 1 4 5 trisphosphate receptors and protects them from proteolytic cleavage J Biol Chem 288 25340 25349 PMID 23884412 DOI 10 1074 jbc M113 496570PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 16 lipnya 2017 Procitovano 28 serpnya 2017 angl Arhiv originalu za 19 lipnya 2017 Procitovano 28 serpnya 2017 Div takozhHromosoma 2 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi