HTRA2 (англ. HtrA serine peptidase 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. Довжина поліпептидного ланцюга білка становить 458 амінокислот, а молекулярна маса — 48 841.
HTRA2 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | HTRA2, Htra2, AI481710, Omi, Prss25, mnd2, PARK13, HtrA serine peptidase 2, MGCA8 | ||||||||||||||||
Зовнішні ІД | OMIM: 606441 MGI: 1928676 HomoloGene: 113300 GeneCards: HTRA2 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 2: 74.53 – 74.53 Mb | Хр. 6: 83.03 – 83.03 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MAAPRAGRGA | GWSLRAWRAL | GGIRWGRRPR | LTPDLRALLT | SGTSDPRARV | ||||
TYGTPSLWAR | LSVGVTEPRA | CLTSGTPGPR | AQLTAVTPDT | RTREASENSG | ||||
TRSRAWLAVA | LGAGGAVLLL | LWGGGRGPPA | VLAAVPSPPP | ASPRSQYNFI | ||||
ADVVEKTAPA | VVYIEILDRH | PFLGREVPIS | NGSGFVVAAD | GLIVTNAHVV | ||||
ADRRRVRVRL | LSGDTYEAVV | TAVDPVADIA | TLRIQTKEPL | PTLPLGRSAD | ||||
VRQGEFVVAM | GSPFALQNTI | TSGIVSSAQR | PARDLGLPQT | NVEYIQTDAA | ||||
IDFGNSGGPL | VNLDGEVIGV | NTMKVTAGIS | FAIPSDRLRE | FLHRGEKKNS | ||||
SSGISGSQRR | YIGVMMLTLS | PSILAELQLR | EPSFPDVQHG | VLIHKVILGS | ||||
PAHRAGLRPG | DVILAIGEQM | VQNAEDVYEA | VRTQSQLAVQ | IRRGRETLTL | ||||
YVTPEVTE |
Кодований геном білок за функціями належить до гідролаз, протеаз, серинових протеаз. Задіяний у таких біологічних процесах як апоптоз, поліморфізм, альтернативний сплайсинг. Локалізований у мембрані, мітохондрії.
Література
- Faccio L., Fusco C., Viel A., Zervos A.S. (2000). Tissue-specific splicing of Omi stress-regulated endoprotease leads to an inactive protease with a modified PDZ motif. Genomics. 68: 343—347. PMID 10995577 DOI:10.1006/geno.2000.6263
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Bartke T., Pohl C., Pyrowolakis G., Jentsch S. (2004). Dual role of BRUCE as an antiapoptotic IAP and a chimeric E2/E3 ubiquitin ligase. Mol. Cell. 14: 801—811. PMID 15200957 DOI:10.1016/j.molcel.2004.05.018
- Simon-Sanchez J., Singleton A.B. (2008). Sequencing analysis of OMI/HTRA2 shows previously reported pathogenic mutations in neurologically normal controls. Hum. Mol. Genet. 17: 1988—1993. PMID 18364387 DOI:10.1093/hmg/ddn096
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 19 серпня 2017. Процитовано 28 серпня 2017.
- (англ.) . Архів оригіналу за 21 липня 2017. Процитовано 28 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
HTRA2 angl HtrA serine peptidase 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 2 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 458 aminokislot a molekulyarna masa 48 841 HTRA2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1LCY 2PZDIdentifikatoriSimvoliHTRA2 Htra2 AI481710 Omi Prss25 mnd2 PARK13 HtrA serine peptidase 2 MGCA8Zovnishni ID OMIM 606441 MGI 1928676 HomoloGene 113300 GeneCards HTRA2Ontologiya genaMolekulyarna funkciya unfolded protein binding GO 0001948 GO 0016582 protein binding serine type peptidase activity serine type endopeptidase activity hydrolase activity GO 0070122 peptidase activity identical protein bindingKlitinna komponenta integral component of membrane gialoplazma endoplasmic reticulum membrane membrana mitohondrialna membrana mitohondrialnij mizhmembrannij prostir endoplazmatichnij retikulum mitohondriya CD40 receptor complex cytoplasmic side of plasma membrane Hromatin citoskelet klitinne yadro serine type endopeptidase complexBiologichnij proces cellular response to retinoic acid cellular response to heat positive regulation of cell death ceramide metabolic process cellular response to interferon beta regulation of multicellular organism growth positive regulation of protein targeting to mitochondrion execution phase of apoptosis adult locomotory behavior cellular response to growth factor stimulus pentacyclic triterpenoid metabolic process mitochondrion organization negative regulation of cell cycle neuron development protein autoprocessing positive regulation of cysteine type endopeptidase activity involved in apoptotic signaling pathway negative regulation of cell death intrinsic apoptotic signaling pathway positive regulation of extrinsic apoptotic signaling pathway in absence of ligand regulation of autophagy of mitochondrion intrinsic apoptotic signaling pathway in response to DNA damage positive regulation of apoptotic process forebrain development negative regulation of oxidative stress induced intrinsic apoptotic signaling pathway response to herbicide adult walking behavior negative regulation of neuron death GO 0097285 apoptoz GO 0010260 starinnya lyudini proteoliz positive regulation of mitochondrion organization cellular response to oxidative stress negative regulation of mitophagy in response to mitochondrial depolarization positive regulation of cysteine type endopeptidase activity involved in apoptotic process protein homotrimerizationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez27429 64704Ensembl ENSG00000115317 ENSMUSG00000068329UniProt O43464 Q9JIY5RefSeq mRNK NM 013247 NM 145074 NM 001321727 NM 001321728NM 019752RefSeq bilok NP 001308656 NP 001308657 NP 037379 NP 659540NP 062726Lokus UCSC Hr 2 74 53 74 53 MbHr 6 83 03 83 03 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAAPRAGRGAGWSLRAWRALGGIRWGRRPRLTPDLRALLTSGTSDPRARV TYGTPSLWARLSVGVTEPRACLTSGTPGPRAQLTAVTPDTRTREASENSG TRSRAWLAVALGAGGAVLLLLWGGGRGPPAVLAAVPSPPPASPRSQYNFI ADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVV ADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSAD VRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAA IDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNS SSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGS PAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTL YVTPEVTE A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do gidrolaz proteaz serinovih proteaz Zadiyanij u takih biologichnih procesah yak apoptoz polimorfizm alternativnij splajsing Lokalizovanij u membrani mitohondriyi LiteraturaFaccio L Fusco C Viel A Zervos A S 2000 Tissue specific splicing of Omi stress regulated endoprotease leads to an inactive protease with a modified PDZ motif Genomics 68 343 347 PMID 10995577 DOI 10 1006 geno 2000 6263 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Bartke T Pohl C Pyrowolakis G Jentsch S 2004 Dual role of BRUCE as an antiapoptotic IAP and a chimeric E2 E3 ubiquitin ligase Mol Cell 14 801 811 PMID 15200957 DOI 10 1016 j molcel 2004 05 018 Simon Sanchez J Singleton A B 2008 Sequencing analysis of OMI HTRA2 shows previously reported pathogenic mutations in neurologically normal controls Hum Mol Genet 17 1988 1993 PMID 18364387 DOI 10 1093 hmg ddn096PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 19 serpnya 2017 Procitovano 28 serpnya 2017 angl Arhiv originalu za 21 lipnya 2017 Procitovano 28 serpnya 2017 Div takozhHromosoma 2 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi