Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

CASP3 англ Caspase 3 білок який кодується однойменним геном розташованим у людей на короткому плечі 4 ї хромосоми Довжин

CASP3

CASP3

CASP3 (англ. Caspase 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. Довжина поліпептидного ланцюга білка становить 277 амінокислот, а молекулярна маса — 31 608.

CASP3
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CASP3, CPP32, CPP32B, SCA-1, caspase 3
Зовнішні ІД OMIM: 600636 MGI: 107739 HomoloGene: 37912 GeneCards: CASP3
Реагує на сполуку
emricasan
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
836
12367
Ensembl
ENSG00000164305
ENSMUSG00000031628
UniProt
P42574
P70677
RefSeq (мРНК)
NM_004346
NM_032991
NM_009810
NM_001284409
RefSeq (білок)
NP_001271338
NP_033940
Локус (UCSC) н/д Хр. 8: 47.07 – 47.09 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIII
NNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELM
RDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRS
LTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTA
PGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESF
SFDATFHAKKQIPCIVSMLTKELYFYH

Кодований геном білок за функціями належить до гідролаз, протеаз, тіолових протеаз, фосфопротеїнів. Задіяний у таких біологічних процесах як апоптоз, поліморфізм, ацетиляція. Локалізований у цитоплазмі.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Bartke T., Pohl C., Pyrowolakis G., Jentsch S. (2004). Dual role of BRUCE as an antiapoptotic IAP and a chimeric E2/E3 ubiquitin ligase. Mol. Cell. 14: 801—811. PMID 15200957 DOI:10.1016/j.molcel.2004.05.018
  • Cabrera J.R., Bouzas-Rodriguez J., Tauszig-Delamasure S., Mehlen P. (2011). RET modulates cell adhesion via its cleavage by caspase in sympathetic neurons. J. Biol. Chem. 286: 14628—14638. PMID 21357690 DOI:10.1074/jbc.M110.195461
  • Fernandes-Alnemri T., Litwack G., Alnemri E.S. (1994). CPP32, a novel human apoptotic protein with homology to Caenorhabditis elegans cell death protein Ced-3 and mammalian interleukin-1 beta-converting enzyme. J. Biol. Chem. 269: 30761—30764. PMID 7983002

Примітки

  1. Сполуки, які фізично взаємодіють з Caspase 3 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:1504 (англ.) . Процитовано 30 серпня 2017.
  5. (англ.) . Архів оригіналу за 3 вересня 2017. Процитовано 30 серпня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

CASP3 angl Caspase 3 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 4 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 277 aminokislot a molekulyarna masa 31 608 CASP3Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1CP3 1GFW 1I3O 1NME 1NMQ 1NMS 1PAU 1QX3 1RE1 1RHJ 1RHK 1RHM 1RHQ 1RHR 1RHU 2C1E 2C2K 2C2M 2C2O 2CDR 2CJX 2CJY 2CNK 2CNL 2CNN 2CNO 2DKO 2H5I 2H5J 2H65 2J30 2J31 2J32 2J33 2XYG 2XYH 2XYP 2XZD 2XZT 2Y0B 3DEH 3DEI 3DEJ 3DEK 3EDQ 3GJQ 3GJR 3GJS 3GJT 3H0E 3ITN 3KJF 3PCX 3PD0 3PD1 4DCJ 4DCO 4DCP 4EHA 4EHD 4EHF 4EHH 4EHK 4EHL 4EHN 4JJE 4JQY 4JQZ 4JR0 4PRY 4PS0 4QTX 4QTY 4QU0 4QU5 4QU8 4QU9 4QUA 4QUB 4QUD 4QUE 4QUG 4QUH 4QUI 4QUJ 4QUL 5IC4IdentifikatoriSimvoliCASP3 CPP32 CPP32B SCA 1 caspase 3Zovnishni ID OMIM 600636 MGI 107739 HomoloGene 37912 GeneCards CASP3Reaguye na spolukuemricasan Ontologiya genaMolekulyarna funkciya cysteine type peptidase activity GO 0070122 peptidase activity GO 0001948 GO 0016582 protein binding phospholipase A2 activator activity cyclin dependent protein serine threonine kinase inhibitor activity cysteine type endopeptidase activity involved in apoptotic process cysteine type endopeptidase activity involved in execution phase of apoptosis cysteine type endopeptidase activity hydrolase activity cysteine type endopeptidase activator activity involved in apoptotic process aspartic type endopeptidase activity protease binding death receptor binding GO 0032403 protein containing complex binding cysteine type endopeptidase activity involved in apoptotic signaling pathwayKlitinna komponenta citoplazma gialoplazma nukleoplazma death inducing signaling complex membrane raft klitinne yadro neuronal cell bodyBiologichnij proces cellular response to organic substance neuron apoptotic process cell fate commitment response to estradiol GO 0007243 intracellular signal transduction response to hypoxia response to amino acid apoptotic DNA fragmentation GO 1904578 response to organic cyclic compound negative regulation of cyclin dependent protein serine threonine kinase activity GO 1904576 response to antibiotic Trombocitopoez protein processing response to nicotine response to metal ion negative regulation of cell cycle Zagoyennya ran response to glucocorticoid GO 1904579 cellular response to organic cyclic compound B cell homeostasis negative regulation of apoptotic process sluh response to glucose response to organic substance hippo signaling glial cell apoptotic process keratinocyte differentiation proteoliz cellular response to DNA damage stimulus T cell homeostasis response to tumor necrosis factor negative regulation of activated T cell proliferation heart development response to lipopolysaccharide positive regulation of neuron apoptotic process response to wounding neuron differentiation extrinsic apoptotic signaling pathway in absence of ligand learning or memory positive regulation of apoptotic process erythrocyte differentiation apoptotic signaling pathway negative regulation of B cell proliferation response to cobalt ion hippocampus development response to UV response to X ray response to hydrogen peroxide regulation of macroautophagy neurotrophin TRK receptor signaling pathway execution phase of apoptosis intrinsic apoptotic signaling pathway in response to osmotic stress cellular response to staurosporine GO 0097285 apoptoz cytokine mediated signaling pathway activation of cysteine type endopeptidase activity involved in apoptotic process GO 0048554 positive regulation of catalytic activity luteolysis axonal fasciculation striated muscle cell differentiation leukocyte apoptotic process regulation of protein stability positive regulation of amyloid beta formation anterior neural tube closureDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez836 12367Ensembl ENSG00000164305 ENSMUSG00000031628UniProt P42574 P70677RefSeq mRNK NM 004346 NM 032991NM 009810 NM 001284409RefSeq bilok NP 004337 NP 116786 NP 001341706 NP 001341708 NP 001341709NP 001341710 NP 001341711 NP 001341712 NP 001341713NP 001271338 NP 033940Lokus UCSC n dHr 8 47 07 47 09 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIII NNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELM RDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRS LTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTA PGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESF SFDATFHAKKQIPCIVSMLTKELYFYH A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do gidrolaz proteaz tiolovih proteaz fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak apoptoz polimorfizm acetilyaciya Lokalizovanij u citoplazmi LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Bartke T Pohl C Pyrowolakis G Jentsch S 2004 Dual role of BRUCE as an antiapoptotic IAP and a chimeric E2 E3 ubiquitin ligase Mol Cell 14 801 811 PMID 15200957 DOI 10 1016 j molcel 2004 05 018 Cabrera J R Bouzas Rodriguez J Tauszig Delamasure S Mehlen P 2011 RET modulates cell adhesion via its cleavage by caspase in sympathetic neurons J Biol Chem 286 14628 14638 PMID 21357690 DOI 10 1074 jbc M110 195461 Fernandes Alnemri T Litwack G Alnemri E S 1994 CPP32 a novel human apoptotic protein with homology to Caenorhabditis elegans cell death protein Ced 3 and mammalian interleukin 1 beta converting enzyme J Biol Chem 269 30761 30764 PMID 7983002PrimitkiSpoluki yaki fizichno vzayemodiyut z Caspase 3 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1504 angl Procitovano 30 serpnya 2017 angl Arhiv originalu za 3 veresnya 2017 Procitovano 30 serpnya 2017 Div takozhHromosoma 4 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ