OPRL1 (англ. Opioid related nociceptin receptor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми. Довжина поліпептидного ланцюга білка становить 370 амінокислот, а молекулярна маса — 40 693.
OPRL1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | OPRL1, KOR-3, NOCIR, OOR, ORL1, NOP, NOPr, opioid related nociceptin receptor 1, KOR3, OPRL, PNOCR | ||||||||||||||||
Зовнішні ІД | OMIM: 602548 MGI: 97440 HomoloGene: 22609 GeneCards: OPRL1 | ||||||||||||||||
Реагує на сполуку | |||||||||||||||||
cebranopadol, nociceptin, Ro64-6198, j-113397, jtc-801 free base, SB 612111, cebranopadol, LY-2940094 | |||||||||||||||||
| |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 20: 64.08 – 64.1 Mb | Хр. 2: 181.36 – 181.36 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MEPLFPAPFW | EVIYGSHLQG | NLSLLSPNHS | LLPPHLLLNA | SHGAFLPLGL | ||||
KVTIVGLYLA | VCVGGLLGNC | LVMYVILRHT | KMKTATNIYI | FNLALADTLV | ||||
LLTLPFQGTD | ILLGFWPFGN | ALCKTVIAID | YYNMFTSTFT | LTAMSVDRYV | ||||
AICHPIRALD | VRTSSKAQAV | NVAIWALASV | VGVPVAIMGS | AQVEDEEIEC | ||||
LVEIPTPQDY | WGPVFAICIF | LFSFIVPVLV | ISVCYSLMIR | RLRGVRLLSG | ||||
SREKDRNLRR | ITRLVLVVVA | VFVGCWTPVQ | VFVLAQGLGV | QPSSETAVAI | ||||
LRFCTALGYV | NSCLNPILYA | FLDENFKACF | RKFCCASALR | RDVQVSDRVR | ||||
SIAKDVALAC | KTSETVPRPA |
Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, , фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані, цитоплазматичних везикулах.
Література
- Serhan C.N., Fierro I.M., Chiang N., Pouliot M. (2001). Nociceptin stimulates neutrophil chemotaxis and recruitment: Inhibition by aspirin-triggered-15-Epi-lipoxin A4. J. Immunol. 166: 3650—3654. PMID 11238602 DOI:10.4049/jimmunol.166.6.3650
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Wick M.J., Minnerath S.R., Roy S., Ramakrishnan S., Loh H.H. (1995). Expression of alternate forms of brain opioid 'orphan' receptor mRNA in activated human peripheral blood lymphocytes and lymphocytic cell lines. Brain Res. Mol. Brain Res. 32: 342—347. PMID 7500847 DOI:10.1016/0169-328X(95)00096-B
- Spampinato S., Di Toro R., Alessandri M., Murari G. (2002). Agonist-induced internalization and desensitization of the human nociceptin receptor expressed in CHO cells. Cell. Mol. Life Sci. 59: 2172—2183. PMID 12568343 DOI:10.1007/s000180200016
Примітки
- Сполуки, які фізично взаємодіють з opioid related nociceptin receptor 1 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:8155 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
OPRL1 angl Opioid related nociceptin receptor 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 20 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 370 aminokislot a molekulyarna masa 40 693 OPRL1Nayavni strukturiPDBPoshuk ortologiv A0A0G2JQE4 PDBe A0A0G2JQE4 RCSB Spisok kodiv PDB4EA3 5DHG 5DHHIdentifikatoriSimvoliOPRL1 KOR 3 NOCIR OOR ORL1 NOP NOPr opioid related nociceptin receptor 1 KOR3 OPRL PNOCRZovnishni ID OMIM 602548 MGI 97440 HomoloGene 22609 GeneCards OPRL1Reaguye na spolukucebranopadol nociceptin Ro64 6198 j 113397 jtc 801 free base SB 612111 cebranopadol LY 2940094 Ontologiya genaMolekulyarna funkciya nociceptin receptor activity neuropeptide binding signal transducer activity G protein coupled opioid receptor activity GO 0001948 GO 0016582 protein binding G protein coupled receptor activity protein C terminus binding peptidnij zv yazokKlitinna komponenta integral component of membrane membrana klitinna membrana integral component of plasma membrane neuron projection GO 0016023 cytoplasmic vesicleBiologichnij proces response to estradiol adenylate cyclase inhibiting G protein coupled receptor signaling pathway sensory perception positive regulation of urine volume harchova povedinka regulation of sensory perception of pain negative regulation of blood pressure estrus regulation of locomotor rhythm positive regulation of gastric acid secretion positive regulation of sensory perception of pain sensory perception of pain negative regulation of voltage gated calcium channel activity neuropeptide signaling pathway GO 0072468 signalna transdukciya chemical synaptic transmission G protein coupled receptor signaling pathway GO 0035737 povedinka tvarin negative regulation of cAMP mediated signaling negative regulation of adenylate cyclase activating G protein coupled receptor signaling pathway G protein coupled opioid receptor signaling pathway positive regulation of cytosolic calcium ion concentration involved in phospholipase C activating G protein coupled signaling pathway conditioned place preferenceDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez4987 18389Ensembl ENSG00000277044 ENSG00000125510 ENSMUSG00000027584UniProt P41146 P35377RefSeq mRNK NM 000913 NM 001200019 NM 182647 NM 001318853 NM 001318854NM 001318855NM 001252565 NM 011012 NM 001318919 NM 001318920 NM 001318922NM 001318923 NM 001318924 NM 001318925RefSeq bilok NP 000904 NP 001186948 NP 001305782 NP 001305783 NP 001305784NP 872588NP 001239494 NP 001305848 NP 001305849 NP 001305851 NP 001305852NP 001305853 NP 001305854 NP 035142Lokus UCSC Hr 20 64 08 64 1 MbHr 2 181 36 181 36 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGL KVTIVGLYLAVCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLV LLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYV AICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVEDEEIEC LVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIRRLRGVRLLSG SREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVR SIAKDVALACKTSETVPRPA A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv g bilokspryazhenih receptoriv fosfoproteyiniv Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Lokalizovanij u klitinnij membrani membrani citoplazmatichnih vezikulah LiteraturaSerhan C N Fierro I M Chiang N Pouliot M 2001 Nociceptin stimulates neutrophil chemotaxis and recruitment Inhibition by aspirin triggered 15 Epi lipoxin A4 J Immunol 166 3650 3654 PMID 11238602 DOI 10 4049 jimmunol 166 6 3650 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Wick M J Minnerath S R Roy S Ramakrishnan S Loh H H 1995 Expression of alternate forms of brain opioid orphan receptor mRNA in activated human peripheral blood lymphocytes and lymphocytic cell lines Brain Res Mol Brain Res 32 342 347 PMID 7500847 DOI 10 1016 0169 328X 95 00096 B Spampinato S Di Toro R Alessandri M Murari G 2002 Agonist induced internalization and desensitization of the human nociceptin receptor expressed in CHO cells Cell Mol Life Sci 59 2172 2183 PMID 12568343 DOI 10 1007 s000180200016PrimitkiSpoluki yaki fizichno vzayemodiyut z opioid related nociceptin receptor 1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 8155 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 8 serpnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 20 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi