Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

Ku70 англ X ray repair cross complementing 6 білок який кодується геном XRCC6 розташованим у людей на короткому плечі 22

Ku70

Ku70

Ku70 (англ. X-ray repair cross complementing 6) – білок, який кодується геном XRCC6, розташованим у людей на короткому плечі 22-ї хромосоми. Довжина поліпептидного ланцюга білка становить 609 амінокислот, а молекулярна маса — 69 843.

XRCC6
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи XRCC6, X-ray repair complementing defective repair in Chinese hamster cells 6, CTC75, CTCBF, G22P1, KU70, ML8, TLAA, X-ray repair cross complementing 6
Зовнішні ІД OMIM: 152690 MGI: 95606 HomoloGene: 37483 GeneCards: XRCC6
Ортологи
Види Людина Миша
Entrez
2547
14375
Ensembl
ENSG00000196419
ENSMUSG00000022471
UniProt
P12956
P23475
RefSeq (мРНК)
NM_001469
NM_001288976
NM_001288977
NM_001288978
NM_010247
RefSeq (білок)
NP_034377
Локус (UCSC) Хр. 22: 41.62 – 41.66 Mb Хр. 15: 81.87 – 81.92 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFE
SQSEDELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFK
NIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVC
ANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFL
DLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKE
TRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKT
RTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGF
KPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRY
TPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTE
KIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEP
EQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGS
GSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELL
EALTKHFQD

Кодований геном білок за функціями належить до ліаз, гідролаз, активаторів, геліказ. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, пошкодження ДНК, репарація ДНК, рекомбінація ДНК. Білок має сайт для зв'язування з АТФ, нуклеотидами, ДНК. Локалізований у ядрі, хромосомах.

Література

  • Griffith A.J., Craft J., Evans J., Mimori T., Hardin J.A. (1992). Nucleotide sequence and genomic structure analyses of the p70 subunit of the human Ku autoantigen: evidence for a family of genes encoding Ku (p70)-related polypeptides. Mol. Biol. Rep. 16: 91—97. PMID 1608402 DOI:10.1007/BF00419754
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Oderwald H., Hughes M.J., Jost J.-P. (1996). Non-histone protein 1 (NHP1) is a member of the Ku protein family which is upregulated in differentiating mouse myoblasts and human promyelocytes. FEBS Lett. 382: 313—318. PMID 8605992 DOI:10.1016/0014-5793(96)00189-5
  • Jin S., Weaver D.T. (1997). Double-strand break repair by Ku70 requires heterodimerization with Ku80 and DNA binding functions. EMBO J. 16: 6874—6885. PMID 9362500 DOI:10.1093/emboj/16.22.6874
  • West R.B., Yaneva M., Lieber M.R. (1998). Productive and nonproductive complexes of Ku and DNA-dependent protein kinase at DNA termini. Mol. Cell. Biol. 18: 5908—5920. PMID 9742108 DOI:10.1128/MCB.18.10.5908
  • Chan D.W., Ye R., Veillette C.J., Lees-Miller S.P. (1999). DNA-dependent protein kinase phosphorylation sites in Ku 70/80 heterodimer. Biochemistry. 38: 1819—1828. PMID 10026262 DOI:10.1021/bi982584b

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. (англ.) . Архів оригіналу за 15 березня 2018. Процитовано 6 лютого 2017.
  4. (англ.) . Архів оригіналу за 10 лютого 2017. Процитовано 6 лютого 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

Ku70 angl X ray repair cross complementing 6 bilok yakij koduyetsya genom XRCC6 roztashovanim u lyudej na korotkomu plechi 22 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 609 aminokislot a molekulyarna masa 69 843 XRCC6Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1JEQ 1JEY 1JJR 3RZXIdentifikatoriSimvoliXRCC6 X ray repair complementing defective repair in Chinese hamster cells 6 CTC75 CTCBF G22P1 KU70 ML8 TLAA X ray repair cross complementing 6Zovnishni ID OMIM 152690 MGI 95606 HomoloGene 37483 GeneCards XRCC6Ontologiya genaMolekulyarna funkciya nucleotide binding double stranded telomeric DNA binding telomeric DNA binding GO 0008026 helicase activity 5 deoxyribose 5 phosphate lyase activity GO 0004003 DNA helicase activity protein C terminus binding katalitichna aktivnist GO 0001948 GO 0016582 protein binding lyase activity hydrolase activity ATP binding DNA binding double stranded DNA binding damaged DNA binding RNA binding cyclin binding GO 0032403 protein containing complex bindingKlitinna komponenta gialoplazma nuclear telomere cap complex membrana transcription regulator complex hromosoma nukleoplazma nonhomologous end joining complex klitinne yadro Ku70 Ku80 complex citoplazma extracellular region secretory granule lumen ficolin 1 rich granule lumen protein DNA complex yaderce GO 0009327 protein containing complexBiologichnij proces double strand break repair via classical nonhomologous end joining protein heterotetramerization GO 0009373 regulation of transcription DNA templated regulation of smooth muscle cell proliferation transcription DNA templated cellular response to DNA damage stimulus GO 0060469 GO 0009371 positive regulation of transcription DNA templated DNA ligation establishment of integrated proviral latency obmin rechovin GO 0045996 negative regulation of transcription DNA templated double strand break repair via nonhomologous end joining telomere maintenance positive regulation of type I interferon production GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II DNA duplex unwinding GO 0100026 Reparaciya DNK cellular hyperosmotic salinity response brain development DNA recombination neutrophil degranulation cellular response to gamma radiation cellular response to X ray positive regulation of protein kinase activity activation of innate immune response proces imunnoyi sistemi vrodzhenij imunitetDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez2547 14375Ensembl ENSG00000196419 ENSMUSG00000022471UniProt P12956 P23475RefSeq mRNK NM 001469 NM 001288976 NM 001288977 NM 001288978NM 010247RefSeq bilok NP 001275905 NP 001275906 NP 001275907 NP 001460 NP 001275905 1NP 001460 1NP 034377Lokus UCSC Hr 22 41 62 41 66 MbHr 15 81 87 81 92 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFE SQSEDELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFK NIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVC ANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFL DLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKE TRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKT RTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGF KPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRY TPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTE KIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEP EQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGS GSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELL EALTKHFQD A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do liaz gidrolaz aktivatoriv gelikaz Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi poshkodzhennya DNK reparaciya DNK rekombinaciya DNK Bilok maye sajt dlya zv yazuvannya z ATF nukleotidami DNK Lokalizovanij u yadri hromosomah LiteraturaGriffith A J Craft J Evans J Mimori T Hardin J A 1992 Nucleotide sequence and genomic structure analyses of the p70 subunit of the human Ku autoantigen evidence for a family of genes encoding Ku p70 related polypeptides Mol Biol Rep 16 91 97 PMID 1608402 DOI 10 1007 BF00419754 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Oderwald H Hughes M J Jost J P 1996 Non histone protein 1 NHP1 is a member of the Ku protein family which is upregulated in differentiating mouse myoblasts and human promyelocytes FEBS Lett 382 313 318 PMID 8605992 DOI 10 1016 0014 5793 96 00189 5 Jin S Weaver D T 1997 Double strand break repair by Ku70 requires heterodimerization with Ku80 and DNA binding functions EMBO J 16 6874 6885 PMID 9362500 DOI 10 1093 emboj 16 22 6874 West R B Yaneva M Lieber M R 1998 Productive and nonproductive complexes of Ku and DNA dependent protein kinase at DNA termini Mol Cell Biol 18 5908 5920 PMID 9742108 DOI 10 1128 MCB 18 10 5908 Chan D W Ye R Veillette C J Lees Miller S P 1999 DNA dependent protein kinase phosphorylation sites in Ku 70 80 heterodimer Biochemistry 38 1819 1828 PMID 10026262 DOI 10 1021 bi982584bPrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 15 bereznya 2018 Procitovano 6 lyutogo 2017 angl Arhiv originalu za 10 lyutogo 2017 Procitovano 6 lyutogo 2017 Div takozhHromosoma 22 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ