Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

TBXA2R англ Thromboxane A2 receptor білок який кодується однойменним геном розташованим у людей на короткому плечі 19 ї

TBXA2R

TBXA2R

TBXA2R (англ. Thromboxane A2 receptor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми. Довжина поліпептидного ланцюга білка становить 343 амінокислот, а молекулярна маса — 37 431.

TBXA2R
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TBXA2R, BDPLT13, TXA2-R, thromboxane A2 receptor
Зовнішні ІД OMIM: 188070 MGI: 98496 HomoloGene: 825 GeneCards: TBXA2R
Реагує на сполуку
prostaglandin E2, prostaglandin F2α, U46619, ramatroban, terutroban, ramatroban, picotamide
Шаблон експресії
image

image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
6915
21390
Ensembl
ENSG00000006638
ENSMUSG00000034881
UniProt
P21731
P30987
RefSeq (мРНК)
NM_001060
NM_201636
NM_001277265
NM_009325
NM_001358512
RefSeq (білок)
NP_001051
NP_963998
NP_001264194
NP_033351
NP_001345441
Локус (UCSC) Хр. 19: 3.59 – 3.61 Mb Хр. 10: 81.16 – 81.17 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLA
GARQGGSHTRSSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDP
GCRLCRFMGVVMIFFGLSPLLLGAAMASERYLGITRPFSRPAVASQRRAW
ATVGLVWAAALALGLLPLLGVGRYTVQYPGSWCFLTLGAESGDVAFGLLF
SMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSEVEMMAQLLGI
MVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, , фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Hirata T., Ushikubi F., Kakizuka A., Okuma M., Narumiya S. (1996). Two thromboxane A2 receptor isoforms in human platelets. Opposite coupling to adenylyl cyclase with different sensitivity to Arg60 to Leu mutation. J. Clin. Invest. 97: 949—956. PMID 8613548 DOI:10.1172/JCI118518
  • Parent A., Laroche G., Hamelin E., Parent J.L. (2008). RACK1 regulates the cell surface expression of the G protein-coupled receptor for thromboxane A(2). Traffic. 9: 394—407. PMID 18088317 DOI:10.1111/j.1600-0854.2007.00692.x
  • Tokue S., Sasaki M., Nakahata N. (2009). Thromboxane A2-induced signal transduction is negatively regulated by KIAA1005 that directly interacts with thromboxane A2 receptor. Prostaglandins Other Lipid Mediat. 89: 8—15. PMID 19464661 DOI:10.1016/j.prostaglandins.2009.02.001
  • D'Angelo D.D., Davis M.G., Ali S., Dorn G.W. II (1994). Cloning and pharmacologic characterization of a thromboxane A2 receptor from K562 (human chronic myelogenous leukemia) cells. J. Pharmacol. Exp. Ther. 271: 1034—1041. PMID 7965765
  • Funk C.D., Furci L., Moran N., Fitzgerald G.A. (1993). Point mutation in the seventh hydrophobic domain of the human thromboxane A2 receptor allows discrimination between agonist and antagonist binding sites. Mol. Pharmacol. 44: 934—939. PMID 8246916

Примітки

  1. Сполуки, які фізично взаємодіють з TBXA2R переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. (англ.) . Архів оригіналу за 13 березня 2016. Процитовано 12 вересня 2017.
  5. (англ.) . Архів оригіналу за 23 вересня 2017. Процитовано 12 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

TBXA2R angl Thromboxane A2 receptor bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 343 aminokislot a molekulyarna masa 37 431 TBXA2RNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1LBNIdentifikatoriSimvoliTBXA2R BDPLT13 TXA2 R thromboxane A2 receptorZovnishni ID OMIM 188070 MGI 98496 HomoloGene 825 GeneCards TBXA2RReaguye na spolukuprostaglandin E2 prostaglandin F2a U46619 ramatroban terutroban ramatroban picotamideOntologiya genaMolekulyarna funkciya G protein coupled receptor activity thromboxane receptor activity guanyl nucleotide exchange factor activity signal transducer activity thromboxane A2 receptor activity GO 0001948 GO 0016582 protein bindingKlitinna komponenta integral component of membrane membrana integral component of plasma membrane Akrosoma klitinna membrana nuclear speckBiologichnij proces G protein coupled receptor signaling pathway response to nutrient positive regulation of angiogenesis GO 0072468 signalna transdukciya cellular response to lipopolysaccharide positive regulation of blood pressure response to ethanol thromboxane A2 signaling pathway positive regulation of blood coagulation positive regulation of vasoconstriction response to testosterone positive regulation of cytosolic calcium ion concentration inflammatory response regulation of vasoconstriction second messenger mediated signaling response to lipopolysaccharide positive regulation of smooth muscle contraction negative regulation of cell migration involved in sprouting angiogenesis adenylate cyclase activating G protein coupled receptor signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez6915 21390Ensembl ENSG00000006638 ENSMUSG00000034881UniProt P21731 P30987RefSeq mRNK NM 001060 NM 201636NM 001277265 NM 009325 NM 001358512RefSeq bilok NP 001051 NP 963998NP 001264194 NP 033351 NP 001345441Lokus UCSC Hr 19 3 59 3 61 MbHr 10 81 16 81 17 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTRSSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPLLLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPGSWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSEVEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWNQILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv g bilokspryazhenih receptoriv fosfoproteyiniv Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Lokalizovanij u klitinnij membrani membrani LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Hirata T Ushikubi F Kakizuka A Okuma M Narumiya S 1996 Two thromboxane A2 receptor isoforms in human platelets Opposite coupling to adenylyl cyclase with different sensitivity to Arg60 to Leu mutation J Clin Invest 97 949 956 PMID 8613548 DOI 10 1172 JCI118518 Parent A Laroche G Hamelin E Parent J L 2008 RACK1 regulates the cell surface expression of the G protein coupled receptor for thromboxane A 2 Traffic 9 394 407 PMID 18088317 DOI 10 1111 j 1600 0854 2007 00692 x Tokue S Sasaki M Nakahata N 2009 Thromboxane A2 induced signal transduction is negatively regulated by KIAA1005 that directly interacts with thromboxane A2 receptor Prostaglandins Other Lipid Mediat 89 8 15 PMID 19464661 DOI 10 1016 j prostaglandins 2009 02 001 D Angelo D D Davis M G Ali S Dorn G W II 1994 Cloning and pharmacologic characterization of a thromboxane A2 receptor from K562 human chronic myelogenous leukemia cells J Pharmacol Exp Ther 271 1034 1041 PMID 7965765 Funk C D Furci L Moran N Fitzgerald G A 1993 Point mutation in the seventh hydrophobic domain of the human thromboxane A2 receptor allows discrimination between agonist and antagonist binding sites Mol Pharmacol 44 934 939 PMID 8246916PrimitkiSpoluki yaki fizichno vzayemodiyut z TBXA2R pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 13 bereznya 2016 Procitovano 12 veresnya 2017 angl Arhiv originalu za 23 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 19Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ