Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

ADRA2A англ Adrenoceptor alpha 2A білок який кодується однойменним геном розташованим у людей на короткому плечі 10 ї хр

ADRA2A

ADRA2A

ADRA2A (англ. Adrenoceptor alpha 2A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми. Довжина поліпептидного ланцюга білка становить 450 амінокислот, а молекулярна маса — 48 957.

ADRA2A
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ADRA2A, ADRA2, ADRA2R, ADRAR, ALPHA2AAR, ZNF32, adrenoceptor alpha 2A
Зовнішні ІД OMIM: 104210 MGI: 87934 HomoloGene: 47944 GeneCards: ADRA2A
Реагує на сполуку
apraclonidine, guanabenz, адреналін, brimonidine, норадреналін, апоморфін, клонідин, dexmedetomidine, guanfacine, оксиметазолін, pergolide, xylazine, brl-44408, бромокриптин, каберголін, хлорпромазин, lisuride, lurasidone, міртазапін, Фентоламін, пірибедил, празозин, α-yohimbine, spiroxatrine, terguride, tolazoline, WB-4101, yohimbine, levonordefrin, адреналін, норадреналін, Ефедрин, apraclonidine hydrochloride, dipivefrin hydrochloride, oxymetazoline hydrochloride, phenoxybenzamine hydrochloride, dexmedetomidine hydrochloride
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
150
11551
Ensembl
ENSG00000150594
ENSMUSG00000033717
UniProt
P08913
Q01338
RefSeq (мРНК)
NM_000681
NM_007417
RefSeq (білок)
NP_000672
NP_031443
Локус (UCSC) Хр. 10: 111.08 – 111.08 Mb Хр. 19: 54.03 – 54.04 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLLTVFG
NVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWY
FGKAWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRI
KAIIITVWVISAVISFPPLISIEKKGGGGGPQPAEPRCEINDQKWYVISS
CIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVAAPPGGTERRP
NGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGPRDTDALDLEESSSSD
HAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPG
EERVGAAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVG
CSVPRTLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, , фосфопротеїнів. Локалізований у клітинній мембрані, мембрані.

Література

  • Small K.M., Forbes S.L., Brown K.M., Liggett S.B. (2000). An Asn to Lys polymorphism in the third intracellular loop of the human alpha 2A-adrenergic receptor imparts enhanced agonist-promoted Gi coupling. J. Biol. Chem. 275: 38518—38523. PMID 10948191 DOI:10.1074/jbc.M004550200
  • Small K.M., Brown K.M., Seman C.A., Theiss C.T., Liggett S.B. (2006). Complex haplotypes derived from noncoding polymorphisms of the intronless alpha-2A-adrenergic gene diversify receptor expression. Proc. Natl. Acad. Sci. U.S.A. 103: 5472—5477. PMID 16567612 DOI:10.1073/pnas.0601345103
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Chhajlani V., Rangel N., Uhlen S., Wikberg J.E.S. (1991). Identification of an additional gene belonging to the alpha 2 adrenergic receptor family in the human genome by PCR. FEBS Lett. 280: 241—244. PMID 1849485 DOI:10.1016/0014-5793(91)80301-I
  • Li C., Fan Y., Lan T.H., Lambert N.A., Wu G. (2012). Rab26 modulates the cell surface transport of alpha2-adrenergic receptors from the Golgi. J. Biol. Chem. 287: 42784—42794. PMID 23105096 DOI:10.1074/jbc.M112.410936
  • Fraser C.M., Arakawa S., McCombie W.R., Venter J.C. (1989). Cloning, sequence analysis, and permanent expression of a human alpha 2-adrenergic receptor in Chinese hamster ovary cells. Evidence for independent pathways of receptor coupling to adenylate cyclase attenuation and activation. J. Biol. Chem. 264: 11754—11761. PMID 2568356

Примітки

  1. Сполуки, які фізично взаємодіють з Adrenoceptor alpha 2A переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. (англ.) . Архів оригіналу за 15 червня 2017. Процитовано 8 вересня 2017.
  5. (англ.) . Архів оригіналу за 8 вересня 2017. Процитовано 8 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

ADRA2A angl Adrenoceptor alpha 2A bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 10 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 450 aminokislot a molekulyarna masa 48 957 ADRA2ANayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1HLL 1HO9 1HOD 1HOFIdentifikatoriSimvoliADRA2A ADRA2 ADRA2R ADRAR ALPHA2AAR ZNF32 adrenoceptor alpha 2AZovnishni ID OMIM 104210 MGI 87934 HomoloGene 47944 GeneCards ADRA2AReaguye na spolukuapraclonidine guanabenz adrenalin brimonidine noradrenalin apomorfin klonidin dexmedetomidine guanfacine oksimetazolin pergolide xylazine brl 44408 bromokriptin kabergolin hlorpromazin lisuride lurasidone mirtazapin Fentolamin piribedil prazozin a yohimbine spiroxatrine terguride tolazoline WB 4101 yohimbine levonordefrin adrenalin noradrenalin Efedrin apraclonidine hydrochloride dipivefrin hydrochloride oxymetazoline hydrochloride phenoxybenzamine hydrochloride dexmedetomidine hydrochlorideOntologiya genaMolekulyarna funkciya alpha 2C adrenergic receptor binding G protein coupled receptor activity protein homodimerization activity epinephrine binding norepinephrine binding alpha 1B adrenergic receptor binding signal transducer activity adrenergic receptor activity GO 0001948 GO 0016582 protein binding alpha2 adrenergic receptor activity protein heterodimerization activity thioesterase binding heterotrimeric G protein binding protein kinase bindingKlitinna komponenta integral component of membrane membrana receptor complex klitinna membrana integral component of plasma membrane basolateral plasma membrane citoplazmaBiologichnij proces G protein coupled receptor signaling pathway positive regulation of epidermal growth factor activated receptor activity activation of protein kinase B activity negative regulation of insulin secretion positive regulation of MAP kinase activity negative regulation of epinephrine secretion glucose homeostasis regulation of smooth muscle contraction GO 0032737 positive regulation of cytokine production regulation of insulin secretion positive regulation of cell migration positive regulation of potassium ion transport phospholipase C activating adrenergic receptor signaling pathway positive regulation of wound healing negative regulation of norepinephrine secretion positive regulation of membrane protein ectodomain proteolysis negative regulation of insulin secretion involved in cellular response to glucose stimulus adenylate cyclase inhibiting adrenergic receptor signaling pathway negative regulation of calcium ion transmembrane transporter activity cellular response to hormone stimulus regulation of vasoconstriction negative regulation of calcium ion dependent exocytosis Rho protein signal transduction positive regulation of cell population proliferation negative regulation of calcium ion transport intestinal absorption Ras protein signal transduction negative regulation of lipid catabolic process activation of protein kinase activity actin cytoskeleton organization GO 0072468 signalna transdukciya platelet activation positive regulation of MAPK cascade adrenergic receptor signaling pathway adenylate cyclase inhibiting G protein coupled receptor signaling pathway adenylate cyclase activating G protein coupled receptor signaling pathway adenylate cyclase activating adrenergic receptor signaling pathway receptor transactivation adenylate cyclase modulating G protein coupled receptor signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez150 11551Ensembl ENSG00000150594 ENSMUSG00000033717UniProt P08913 Q01338RefSeq mRNK NM 000681NM 007417RefSeq bilok NP 000672NP 031443Lokus UCSC Hr 10 111 08 111 08 MbHr 19 54 03 54 04 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGGPQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVAAPPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGPRDTDALDLEESSSSDHAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGDRKRIVA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv g bilokspryazhenih receptoriv fosfoproteyiniv Lokalizovanij u klitinnij membrani membrani LiteraturaSmall K M Forbes S L Brown K M Liggett S B 2000 An Asn to Lys polymorphism in the third intracellular loop of the human alpha 2A adrenergic receptor imparts enhanced agonist promoted Gi coupling J Biol Chem 275 38518 38523 PMID 10948191 DOI 10 1074 jbc M004550200 Small K M Brown K M Seman C A Theiss C T Liggett S B 2006 Complex haplotypes derived from noncoding polymorphisms of the intronless alpha 2A adrenergic gene diversify receptor expression Proc Natl Acad Sci U S A 103 5472 5477 PMID 16567612 DOI 10 1073 pnas 0601345103 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Chhajlani V Rangel N Uhlen S Wikberg J E S 1991 Identification of an additional gene belonging to the alpha 2 adrenergic receptor family in the human genome by PCR FEBS Lett 280 241 244 PMID 1849485 DOI 10 1016 0014 5793 91 80301 I Li C Fan Y Lan T H Lambert N A Wu G 2012 Rab26 modulates the cell surface transport of alpha2 adrenergic receptors from the Golgi J Biol Chem 287 42784 42794 PMID 23105096 DOI 10 1074 jbc M112 410936 Fraser C M Arakawa S McCombie W R Venter J C 1989 Cloning sequence analysis and permanent expression of a human alpha 2 adrenergic receptor in Chinese hamster ovary cells Evidence for independent pathways of receptor coupling to adenylate cyclase attenuation and activation J Biol Chem 264 11754 11761 PMID 2568356PrimitkiSpoluki yaki fizichno vzayemodiyut z Adrenoceptor alpha 2A pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 15 chervnya 2017 Procitovano 8 veresnya 2017 angl Arhiv originalu za 8 veresnya 2017 Procitovano 8 veresnya 2017 Div takozhHromosoma 10Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ