WT1 (англ. Wilms tumor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми. Довжина поліпептидного ланцюга білка становить 449 амінокислот, а молекулярна маса — 49 188.
WT1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | WT1, AEWS-GUD, NPHS4, WAGR, WIT-2, WT33, Wilms tumor 1, WT1 transcription factor, WT-1 | ||||||||||||||||
Зовнішні ІД | OMIM: 607102 MGI: 98968 HomoloGene: 11536 GeneCards: WT1 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
Frasier syndrome, Denys-Drash syndrome, Meacham syndrome, familial idiopathic steroid-resistant nephrotic syndrome | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 11: 32.39 – 32.44 Mb | Хр. 2: 104.96 – 105 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MGSDVRDLNA | LLPAVPSLGG | GGGCALPVSG | AAQWAPVLDF | APPGASAYGS | ||||
LGGPAPPPAP | PPPPPPPPHS | FIKQEPSWGG | AEPHEEQCLS | AFTVHFSGQF | ||||
TGTAGACRYG | PFGPPPPSQA | SSGQARMFPN | APYLPSCLES | QPAIRNQGYS | ||||
TVTFDGTPSY | GHTPSHHAAQ | FPNHSFKHED | PMGQQGSLGE | QQYSVPPPVY | ||||
GCHTPTDSCT | GSQALLLRTP | YSSDNLYQMT | SQLECMTWNQ | MNLGATLKGV | ||||
AAGSSSSVKW | TEGQSNHSTG | YESDNHTTPI | LCGAQYRIHT | HGVFRGIQDV | ||||
RRVPGVAPTL | VRSASETSEK | RPFMCAYPGC | NKRYFKLSHL | QMHSRKHTGE | ||||
KPYQCDFKDC | ERRFSRSDQL | KRHQRRHTGV | KPFQCKTCQR | KFSRSDHLKT | ||||
HTRTHTGKTS | EKPFSCRWPS | CQKKFARSDE | LVRHHNMHQR | NMTKLQLAL |
Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК, РНК. Локалізований у цитоплазмі, ядрі.
Література
- Gessler M., Konig A., Bruns G.A.P. (1992). The genomic organization and expression of the WT1 gene. Genomics. 12: 807—813. PMID 1572653 DOI:10.1016/0888-7543(92)90313-H
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Hamilton T.B., Barilla K.C., Romaniuk P.J. (1995). High affinity binding sites for the Wilms' tumour suppressor protein WT1. Nucleic Acids Res. 23: 277—284. PMID 7862533 DOI:10.1093/nar/23.2.277
- Buckler A.J., Pelletier J., Haber D.A., Glaser T., Housman D.E. (1991). Isolation, characterization, and expression of the murine Wilms' tumor gene (WT1) during kidney development. Mol. Cell. Biol. 11: 1707—1712. PMID 1671709 DOI:10.1128/MCB.11.3.1707
- Sharma P.M., Bowman M., Madden S.L., Rauscher F.J. III, Sukumar S. (1994). RNA editing in the Wilms' tumor susceptibility gene, WT1. Genes Dev. 8: 720—731. PMID 7926762 DOI:10.1101/gad.8.6.720
- Bruening W., Pelletier J. (1996). A non-AUG translational initiation event generates novel WT1 isoforms. J. Biol. Chem. 271: 8646—8654. PMID 8621495 DOI:10.1074/jbc.271.15.8646
Примітки
- Захворювання, генетично пов'язані з WT1 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:12796 (англ.) . Процитовано 8 вересня 2017.
- (англ.) . Архів оригіналу за 27 вересня 2017. Процитовано 8 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
WT1 angl Wilms tumor 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 11 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 449 aminokislot a molekulyarna masa 49 188 WT1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1XF7 2JP9 2JPA 2PRT 3HPJ 3MYJ 4R2E 4R2P 4R2Q 4R2R 4R2S 4WUUIdentifikatoriSimvoliWT1 AEWS GUD NPHS4 WAGR WIT 2 WT33 Wilms tumor 1 WT1 transcription factor WT 1Zovnishni ID OMIM 607102 MGI 98968 HomoloGene 11536 GeneCards WT1Pov yazani genetichni zahvoryuvannyaFrasier syndrome Denys Drash syndrome Meacham syndrome familial idiopathic steroid resistant nephrotic syndrome Ontologiya genaMolekulyarna funkciya sequence specific DNA binding DNA binding GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity zinc ion binding GO 0001077 GO 0001212 GO 0001213 GO 0001211 GO 0001205 DNA binding transcription activator activity RNA polymerase II specific C2H2 zinc finger domain binding zv yazuvannya z ionom metalu GO 0001948 GO 0016582 protein binding RNA binding nucleic acid binding double stranded methylated DNA binding hemi methylated DNA binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specificKlitinna komponenta citoplazma nuclear speck nukleoplazma yaderce klitinne yadro gialoplazmaBiologichnij proces germ cell development adrenal cortex formation ureteric bud development negative regulation of translation male gonad development male genitalia development GO 0009373 regulation of transcription DNA templated epithelial cell differentiation glomerular basement membrane development diaphragm development rozvitok nirki GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II posterior mesonephric tubule development visceral serous pericardium development metanephric epithelium development negative regulation of apoptotic process glomerulus development GO 1901227 negative regulation of transcription by RNA polymerase II adrenal gland development transcription DNA templated positive regulation of metanephric ureteric bud development vaskulogenez GO 0060469 GO 0009371 positive regulation of transcription DNA templated positive regulation of heart growth heart development negative regulation of female gonad development branching involved in ureteric bud morphogenesis regulation of animal organ formation Determinaciya stati negative regulation of cell growth Splajsing RNK cardiac muscle cell fate commitment gistogenez positive regulation of apoptotic process camera type eye development metanephric S shaped body morphogenesis thorax and anterior abdomen determination GO 0045996 negative regulation of transcription DNA templated gonad development metanephric mesenchyme development cellular response to gonadotropin stimulus positive regulation of male gonad development cellular response to cAMP negative regulation of cell population proliferation mesenchymal to epithelial transition negative regulation of metanephric glomerular mesangial cell proliferation GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II transcription by RNA polymerase II glomerular visceral epithelial cell differentiation GO 1901313 positive regulation of gene expression positive regulation of pri miRNA transcription by RNA polymerase II positive regulation of DNA methylationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez7490 22431Ensembl ENSG00000184937 ENSMUSG00000016458UniProt P19544 P22561 Q199A7RefSeq mRNK NM 024426 NM 000378 NM 001198551 NM 001198552 NM 024424NM 024425 NM 001367854NM 144783RefSeq bilok NP 000369 NP 001185480 NP 001185481 NP 077742 NP 077744NP 001354783 NP 000369 3 NP 001185480 1 NP 001185481 1 NP 077742 2 NP 077744 3NP 659032Lokus UCSC Hr 11 32 39 32 44 MbHr 2 104 96 105 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFAPPGASAYGS LGGPAPPPAPPPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQF TGTAGACRYGPFGPPPPSQASSGQARMFPNAPYLPSCLESQPAIRNQGYS TVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVY GCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGV AAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDV RRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGE KPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKT HTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLAL A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom cinku DNK RNK Lokalizovanij u citoplazmi yadri LiteraturaGessler M Konig A Bruns G A P 1992 The genomic organization and expression of the WT1 gene Genomics 12 807 813 PMID 1572653 DOI 10 1016 0888 7543 92 90313 H The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Hamilton T B Barilla K C Romaniuk P J 1995 High affinity binding sites for the Wilms tumour suppressor protein WT1 Nucleic Acids Res 23 277 284 PMID 7862533 DOI 10 1093 nar 23 2 277 Buckler A J Pelletier J Haber D A Glaser T Housman D E 1991 Isolation characterization and expression of the murine Wilms tumor gene WT1 during kidney development Mol Cell Biol 11 1707 1712 PMID 1671709 DOI 10 1128 MCB 11 3 1707 Sharma P M Bowman M Madden S L Rauscher F J III Sukumar S 1994 RNA editing in the Wilms tumor susceptibility gene WT1 Genes Dev 8 720 731 PMID 7926762 DOI 10 1101 gad 8 6 720 Bruening W Pelletier J 1996 A non AUG translational initiation event generates novel WT1 isoforms J Biol Chem 271 8646 8654 PMID 8621495 DOI 10 1074 jbc 271 15 8646PrimitkiZahvoryuvannya genetichno pov yazani z WT1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 12796 angl Procitovano 8 veresnya 2017 angl Arhiv originalu za 27 veresnya 2017 Procitovano 8 veresnya 2017 Div takozhHromosoma 11 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi