Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

VEGFA англ Vascular endothelial growth factor A білок який кодується однойменним геном розташованим у людей на короткому

VEGFA

VEGFA

VEGFA (англ. Vascular endothelial growth factor A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми. Довжина поліпептидного ланцюга білка становить 232 амінокислот, а молекулярна маса — 27 042.

VEGFA
image
Наявні структури
PDBПошук ортологів: H0YBI8 PDBe H0YBI8 RCSB
Ідентифікатори
Символи VEGFA, MVCD1, VEGF, VPF, vascular endothelial growth factor A
Зовнішні ІД OMIM: 192240 MGI: 103178 HomoloGene: 2534 GeneCards: VEGFA
Реагує на сполуку
Brolucizumab
Шаблон експресії
image

image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
7422
22339
Ensembl
ENSG00000112715
ENSMUSG00000023951
UniProt
P15692
Q00731
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 6: 43.77 – 43.79 Mb Хр. 17: 46.33 – 46.34 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRS
YCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEES
NITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKG
QKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQ
TCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Кодований геном білок за функціями належить до факторів росту, мітогенів, . Задіяний у таких біологічних процесах, як ангіогенез, диференціація клітин, альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою гепарину. Секретований назовні.

Література

  • Leung D.W., Cachianes G., Kuang W.-J., Goeddel D.V., Ferrara N. (1989). Vascular endothelial growth factor is a secreted angiogenic mitogen. Science. 246: 1306—1309. PMID 2479986 DOI:10.1126/science.2479986
  • Weindel K., Marme D., Weich H.A. (1992). AIDS-associated Kaposi's sarcoma cells in culture express vascular endothelial growth factor. Biochem. Biophys. Res. Commun. 183: 1167—1174. PMID 1567395 DOI:10.1016/S0006-291X(05)80313-4
  • Lei J., Jiang A., Pei D. (1998). Identification and characterization of a new splicing variant of vascular endothelial growth factor: VEGF183. Biochim. Biophys. Acta. 1443: 400—406. PMID 9878851 DOI:10.1016/S0167-4781(98)00240-1
  • Whittle C.J., Gillespie K.M., Harrison R., Mathieson P.W., Harper S.J. (1999). Heterogeneous vascular endothelial growth factor (VEGF) isoform mRNA and receptor mRNA expression in human glomeruli, and the identification of VEGF148 mRNA, a novel truncated splice variant. Clin. Sci. 97: 303—312. PMID 10464055 DOI:10.1042/cs0970303
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 13: 2819—2824. PMID 15340161 DOI:10.1110/ps.04682504

Примітки

  1. Сполуки, які фізично взаємодіють з vascular endothelial growth factor A переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. (англ.) . Архів оригіналу за 6 липня 2017. Процитовано 6 вересня 2017.
  5. (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 6 вересня 2017.

Див. також


image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

VEGFA angl Vascular endothelial growth factor A bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 6 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 232 aminokislot a molekulyarna masa 27 042 VEGFANayavni strukturiPDBPoshuk ortologiv H0YBI8 PDBe H0YBI8 RCSBSpisok kodiv PDB1BJ1 1CZ8 1FLT 1KAT 1KMX 1MJV 1MKG 1MKK 1QTY 1TZH 1TZI 1VGH 1VPF 1VPP 2FJG 2FJH 2QR0 2VGH 2VPF 3BDY 3P9W 3QTK 3S1B 3S1K 3V2A 4DEQ 4GLN 4GLS 4KZN 4QAF 4WPB 4ZFF 5HHC 5FV1 5FV2 5HHD 5DN2IdentifikatoriSimvoliVEGFA MVCD1 VEGF VPF vascular endothelial growth factor AZovnishni ID OMIM 192240 MGI 103178 HomoloGene 2534 GeneCards VEGFAReaguye na spolukuBrolucizumabOntologiya genaMolekulyarna funkciya heparin binding extracellular matrix binding cytokine activity growth factor activity neuropilin binding vascular endothelial growth factor receptor 2 binding receptor ligand activity vascular endothelial growth factor receptor 1 binding protein homodimerization activity platelet derived growth factor receptor binding GO 0001948 GO 0016582 protein binding vascular endothelial growth factor receptor binding fibronectin binding chemoattractant activity identical protein binding protein heterodimerization activityKlitinna komponenta citoplazma membrana extracellular region cell surface secretory granule platelet alpha granule lumen mizhklitinnij prostir GO 0005578 Pozaklitinna matricyaBiologichnij proces cardiac vascular smooth muscle cell development positive regulation of protein phosphorylation positive regulation of MAP kinase activity vascular endothelial growth factor signaling pathway positive regulation of receptor internalization outflow tract morphogenesis mammary gland alveolus development monocyte differentiation cell migration involved in sprouting angiogenesis vaskulogenez positive regulation of retinal ganglion cell axon guidance vascular endothelial growth factor receptor signaling pathway positive regulation of vascular permeability positive regulation of mesenchymal cell proliferation Angiogenez positive regulation of blood vessel endothelial cell migration positive regulation of ERK1 and ERK2 cascade mesoderm development positive regulation of positive chemotaxis positive regulation of p38MAPK cascade positive regulation of neuroblast proliferation dopaminergic neuron differentiation positive regulation of branching involved in ureteric bud morphogenesis rozvitok nirki lung development coronary artery morphogenesis in utero embryonic development cell maturation commissural neuron axon guidance positive regulation of peptidyl serine phosphorylation positive regulation of CREB transcription factor activity basophil chemotaxis artery morphogenesis regulation of transcription from RNA polymerase II promoter in response to hypoxia positive regulation of peptidyl tyrosine autophosphorylation positive regulation of peptidyl tyrosine phosphorylation branching involved in blood vessel morphogenesis positive regulation of protein localization to early endosome primitive erythrocyte differentiation positive regulation of protein kinase D signaling laktaciya diferenciaciya klitin epithelial cell differentiation positive regulation of leukocyte migration positive regulation of epithelial cell proliferation negative regulation of apoptotic process GO 1901227 negative regulation of transcription by RNA polymerase II nejrobiologiya rozvitku macrophage differentiation positive regulation of angiogenesis regulation of retinal ganglion cell axon guidance lymph vessel morphogenesis post embryonic camera type eye development regulation of cell shape ovarian follicle development branching morphogenesis of an epithelial tube coronary vein morphogenesis surfactant homeostasis positive regulation of vascular endothelial growth factor receptor signaling pathway negative regulation of cysteine type endopeptidase activity involved in apoptotic process response to hypoxia positive regulation of endothelial cell proliferation positive regulation of protein containing complex assembly positive regulation of protein kinase C signaling positive regulation of cell migration heart morphogenesis platelet degranulation positive regulation of axon extension involved in axon guidance positive regulation of endothelial cell migration multicellular organism development positive regulation of histone deacetylase activity tube formation GO 1901313 positive regulation of gene expression positive regulation of protein autophosphorylation endothelial cell chemotaxis positive regulation of cell proliferation by VEGF activated platelet derived growth factor receptor signaling pathway positive regulation of endothelial cell chemotaxis by VEGF activated vascular endothelial growth factor receptor signaling pathway eye photoreceptor cell development positive regulation of transcription from RNA polymerase II promoter in response to hypoxia positive regulation of focal adhesion assembly cellular response to vascular endothelial growth factor stimulus activation of protein kinase activity positive regulation of cell division camera type eye morphogenesis GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II positive regulation of cell adhesion cellular response to hypoxia positive chemotaxis GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II positive regulation of cell population proliferation induction of positive chemotaxis positive regulation of mast cell chemotaxis motor neuron migration positive regulation of tyrosine phosphorylation of STAT protein rist VEGF activated neuropilin signaling pathway positive regulation of phosphorylation regulation of signaling receptor activity negative regulation of gene expression cytokine mediated signaling pathway positive regulation of cell migration involved in sprouting angiogenesis cellular stress response to acid chemical positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis positive regulation of sprouting angiogenesis positive regulation of DNA biosynthetic process sprouting angiogenesis regulation of nitric oxide mediated signal transduction positive regulation of cold induced thermogenesis GO 0072468 signalna transdukciyaDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez7422 22339Ensembl ENSG00000112715 ENSMUSG00000023951UniProt P15692 Q00731RefSeq mRNK NM 003376 NM 001025366 NM 001025367 NM 001025368 NM 001025369NM 001025370 NM 001033756 NM 001171622 NM 001171623 NM 001171624 NM 001171625 NM 001171626 NM 001171627 NM 001171628 NM 001171629 NM 001171630 NM 001204384 NM 001204385 NM 001287044 NM 001317010NM 001025250 NM 001025257 NM 001110266 NM 001110267 NM 001110268NM 001287056 NM 001287057 NM 001287058 NM 009505 NM 001317041RefSeq bilok NP 001020537 NP 001020538 NP 001020539 NP 001020540 NP 001020541NP 001028928 NP 001165093 NP 001165094 NP 001165095 NP 001165096 NP 001165097 NP 001165098 NP 001165099 NP 001165100 NP 001165101 NP 001191313 NP 001191314 NP 001273973 NP 001303939 NP 003367NP 001020421 NP 001020428 NP 001103736 NP 001103737 NP 001103738NP 001273985 NP 001273986 NP 001273987 NP 001303970 NP 033531Lokus UCSC Hr 6 43 77 43 79 MbHr 17 46 33 46 34 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRRA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do faktoriv rostu mitogeniv Zadiyanij u takih biologichnih procesah yak angiogenez diferenciaciya klitin alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z molekuloyu geparinu Sekretovanij nazovni LiteraturaLeung D W Cachianes G Kuang W J Goeddel D V Ferrara N 1989 Vascular endothelial growth factor is a secreted angiogenic mitogen Science 246 1306 1309 PMID 2479986 DOI 10 1126 science 2479986 Weindel K Marme D Weich H A 1992 AIDS associated Kaposi s sarcoma cells in culture express vascular endothelial growth factor Biochem Biophys Res Commun 183 1167 1174 PMID 1567395 DOI 10 1016 S0006 291X 05 80313 4 Lei J Jiang A Pei D 1998 Identification and characterization of a new splicing variant of vascular endothelial growth factor VEGF183 Biochim Biophys Acta 1443 400 406 PMID 9878851 DOI 10 1016 S0167 4781 98 00240 1 Whittle C J Gillespie K M Harrison R Mathieson P W Harper S J 1999 Heterogeneous vascular endothelial growth factor VEGF isoform mRNA and receptor mRNA expression in human glomeruli and the identification of VEGF148 mRNA a novel truncated splice variant Clin Sci 97 303 312 PMID 10464055 DOI 10 1042 cs0970303 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Zhang Z Henzel W J 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites Protein Sci 13 2819 2824 PMID 15340161 DOI 10 1110 ps 04682504PrimitkiSpoluki yaki fizichno vzayemodiyut z vascular endothelial growth factor A pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 6 lipnya 2017 Procitovano 6 veresnya 2017 angl Arhiv originalu za 8 serpnya 2017 Procitovano 6 veresnya 2017 Div takozhHromosoma 6 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ