TERF1 (англ. Telomeric repeat binding factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми. Довжина поліпептидного ланцюга білка становить 439 амінокислот, а молекулярна маса — 50 246.
TERF1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | TERF1, PIN2, TRBF1, TRF, TRF1, hTRF1-AS, t-TRF1, telomeric repeat binding factor 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 600951 MGI: 109634 HomoloGene: 7570 GeneCards: TERF1 | ||||||||||||||||
| |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 8: 73.01 – 73.05 Mb | Хр. 1: 15.88 – 15.91 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MAEDVSSAAP | SPRGCADGRD | ADPTEEQMAE | TERNDEEQFE | CQELLECQVQ | ||||
VGAPEEEEEE | EEDAGLVAEA | EAVAAGWMLD | FLCLSLCRAF | RDGRSEDFRR | ||||
TRNSAEAIIH | GLSSLTACQL | RTIYICQFLT | RIAAGKTLDA | QFENDERITP | ||||
LESALMIWGS | IEKEHDKLHE | EIQNLIKIQA | IAVCMENGNF | KEAEEVFERI | ||||
FGDPNSHMPF | KSKLLMIISQ | KDTFHSFFQH | FSYNHMMEKI | KSYVNYVLSE | ||||
KSSTFLMKAA | AKVVESKRTR | TITSQDKPSG | NDVEMETEAN | LDTRKSVSDK | ||||
QSAVTESSEG | TVSLLRSHKN | LFLSKLQHGT | QQQDLNKKER | RVGTPQSTKK | ||||
KKESRRATES | RIPVSKSQPV | TPEKHRARKR | QAWLWEEDKN | LRSGVRKYGE | ||||
GNWSKILLHY | KFNNRTSVML | KDRWRTMKKL | KLISSDSED |
Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинний цикл, поділ клітини, мітоз, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, цитоскелеті, ядрі, хромосомах.
Література
- Broccoli D., Smogorzewska A., Chong L., de Lange T. (1997). Human telomeres contain two distinct Myb-related proteins, TRF1 and TRF2. Nat. Genet. 17: 231—235. PMID 9326950 DOI:10.1038/ng1097-231
- Shen M., Haggblom C., Vogt M., Hunter T., Lu K.P. (1997). Characterization and cell cycle regulation of the related human telomeric proteins Pin2 and TRF1 suggest a role in mitosis. Proc. Natl. Acad. Sci. U.S.A. 94: 13618—13623. PMID 9391075 DOI:10.1073/pnas.94.25.13618
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Nakamura M., Zhen Zhou X., Kishi S., Ping Lu K. (2002). Involvement of the telomeric protein Pin2/TRF1 in the regulation of the mitotic spindle. FEBS Lett. 514: 193—198. PMID 11943150 DOI:10.1016/S0014-5793(02)02363-3
- Cook B.D., Dynek J.N., Chang W., Shostak G., Smith S. (2002). Role for the related poly(ADP-Ribose) polymerases tankyrase 1 and 2 at human telomeres. Mol. Cell. Biol. 22: 332—342. PMID 11739745 DOI:10.1128/MCB.22.1.332-342.2002
- Loayza D., De Lange T. (2003). POT1 as a terminal transducer of TRF1 telomere length control. Nature. 423: 1013—1018. PMID 12768206 DOI:10.1038/nature01688
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 10 травня 2017. Процитовано 7 вересня 2017.
- (англ.) . Архів оригіналу за 7 серпня 2017. Процитовано 7 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
TERF1 angl Telomeric repeat binding factor 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 8 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 439 aminokislot a molekulyarna masa 50 246 TERF1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1BA5 1ITY 1IV6 1W0T 3BQO 3L82 5HKPIdentifikatoriSimvoliTERF1 PIN2 TRBF1 TRF TRF1 hTRF1 AS t TRF1 telomeric repeat binding factor 1Zovnishni ID OMIM 600951 MGI 109634 HomoloGene 7570 GeneCards TERF1Ontologiya genaMolekulyarna funkciya DNA binding double stranded telomeric DNA binding protein homodimerization activity telomeric DNA binding microtubule binding telomerase activity ubiquitin binding GO 0001948 GO 0016582 protein binding G rich strand telomeric DNA binding protein heterodimerization activity DNA binding bending ankyrin repeat binding protein C terminus binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specificKlitinna komponenta citoplazma nuclear telomere cap complex vereteno podilu nukleoplazma hromosoma telomera yaderce citoskelet klitinne yadro fibrillar center yaderni tilcya shelterin complexBiologichnij proces telomere maintenance via telomerase negative regulation of establishment of RNA localization to telomere negative regulation of telomere maintenance via semi conservative replication meiotic telomere clustering negative regulation of establishment of protein localization to telomere negative regulation of telomerase activity negative regulation of DNA replication positive regulation of mitotic cell cycle mitotic spindle assembly checkpoint signaling podil klitini positive regulation of shelterin complex assembly G2 M transition of mitotic cell cycle positive regulation of apoptotic process positive regulation of microtubule polymerization negative regulation of establishment of protein containing complex localization to telomere klitinnij cikl protein homooligomerization positive regulation of mitotic nuclear division telomeric loop formation telomere capping negative regulation of exonuclease activity telomeric D loop disassembly t circle formation negative regulation of telomeric D loop disassembly negative regulation of telomere maintenance via telomerase negative regulation of telomere maintenance via telomere lengthening telomere maintenance GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase IIDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez7013 21749Ensembl ENSG00000147601 ENSMUSG00000025925UniProt P54274 P70371RefSeq mRNK NM 003218 NM 017489NM 001286628 NM 009352RefSeq bilok NP 003209 NP 059523NP 001273557 NP 033378Lokus UCSC Hr 8 73 01 73 05 MbHr 1 15 88 15 91 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAEDVSSAAPSPRGCADGRDADPTEEQMAETERNDEEQFECQELLECQVQ VGAPEEEEEEEEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRR TRNSAEAIIHGLSSLTACQLRTIYICQFLTRIAAGKTLDAQFENDERITP LESALMIWGSIEKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERI FGDPNSHMPFKSKLLMIISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSE KSSTFLMKAAAKVVESKRTRTITSQDKPSGNDVEMETEANLDTRKSVSDK QSAVTESSEGTVSLLRSHKNLFLSKLQHGTQQQDLNKKERRVGTPQSTKK KKESRRATESRIPVSKSQPVTPEKHRARKRQAWLWEEDKNLRSGVRKYGE GNWSKILLHYKFNNRTSVMLKDRWRTMKKLKLISSDSED A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak klitinnij cikl podil klitini mitoz acetilyuvannya alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u citoplazmi citoskeleti yadri hromosomah LiteraturaBroccoli D Smogorzewska A Chong L de Lange T 1997 Human telomeres contain two distinct Myb related proteins TRF1 and TRF2 Nat Genet 17 231 235 PMID 9326950 DOI 10 1038 ng1097 231 Shen M Haggblom C Vogt M Hunter T Lu K P 1997 Characterization and cell cycle regulation of the related human telomeric proteins Pin2 and TRF1 suggest a role in mitosis Proc Natl Acad Sci U S A 94 13618 13623 PMID 9391075 DOI 10 1073 pnas 94 25 13618 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Nakamura M Zhen Zhou X Kishi S Ping Lu K 2002 Involvement of the telomeric protein Pin2 TRF1 in the regulation of the mitotic spindle FEBS Lett 514 193 198 PMID 11943150 DOI 10 1016 S0014 5793 02 02363 3 Cook B D Dynek J N Chang W Shostak G Smith S 2002 Role for the related poly ADP Ribose polymerases tankyrase 1 and 2 at human telomeres Mol Cell Biol 22 332 342 PMID 11739745 DOI 10 1128 MCB 22 1 332 342 2002 Loayza D De Lange T 2003 POT1 as a terminal transducer of TRF1 telomere length control Nature 423 1013 1018 PMID 12768206 DOI 10 1038 nature01688PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 10 travnya 2017 Procitovano 7 veresnya 2017 angl Arhiv originalu za 7 serpnya 2017 Procitovano 7 veresnya 2017 Div takozhHromosoma 8 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi