Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

Src англ SRC proto oncogene non receptor tyrosine kinase білок який кодується геном SRC розташованим у людини на довгому

Src (ген)

Src (ген)

Src (англ. SRC proto-oncogene, non-receptor tyrosine kinase) – білок, який кодується геном SRC, розташованим у людини на довгому плечі 20-ї хромосоми. Довжина поліпептидного ланцюга білка становить 536 амінокислот, а молекулярна маса — 59 835.

Src
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи SRC, ASV, SRC1, c-p60-Src, SRC proto-oncogene, non-receptor tyrosine kinase, THC6
Зовнішні ІД OMIM: 190090 MGI: 98397 HomoloGene: 21120 GeneCards: SRC
2.7.10.2
Реагує на сполуку
бозутиніб, Дазатиніб, saracatinib, SU6656, saracatinib, PD166285
Шаблон експресії
image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
6714
20779
Ensembl
ENSG00000197122
ENSMUSG00000027646
UniProt
P12931
P05480
RefSeq (мРНК)
NM_005417
NM_198291
NM_001025395
NM_009271
RefSeq (білок)
NP_005408
NP_938033
NP_001020566
NP_033297
Локус (UCSC) Хр. 20: 37.34 – 37.41 Mb Хр. 2: 157.42 – 157.47 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGP
SAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTE
TDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEE
WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGL
NVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT
SKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLL
DFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGEN
LVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWS
FGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQ
CWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL

Кодований геном білок за функціями належить до тирозинових протеїнкіназ родини Src-протеїнкіназ.

Задіяний у таких біологічних процесах, як клітинна адгезія, імунітет, взаємодія хазяїн-вірус, клітинний цикл, альтернативний сплайсинг. Білок є ліпопротеїном, має сайт для зв'язування з АТФ. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, ядрі, внутрішній мембрані мітохондрії.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Anderson S.K., Gibbs C.P., Tanaka A., Kung H.-J., Fujita D.J. (1985). Human cellular src gene: nucleotide sequence and derived amino acid sequence of the region coding for the carboxy-terminal two-thirds of pp60c-src. Mol. Cell. Biol. 5: 1122—1129. PMID 2582238 DOI:10.1128/MCB.5.5.1122
  • Pyper J.M., Bolen J.B. (1989). Neuron-specific splicing of C-SRC RNA in human brain. J. Neurosci. Res. 24: 89—96. PMID 2681803 DOI:10.1002/jnr.490240113
  • Parker R.C., Mardon G., Lebo R.V., Varmus H.E., Bishop J.M. (1985). Isolation of duplicated human c-src genes located on chromosomes 1 and 20. Mol. Cell. Biol. 5: 831—838. PMID 2581127 DOI:10.1128/MCB.5.4.831
  • Cartwright C.A., Kamps M.P., Meisler A.I., Pipas J.M., Eckhart W. (1989). pp60c-src activation in human colon carcinoma. J. Clin. Invest. 83: 2025—2033. PMID 2498394 DOI:10.1172/JCI114113
  • Pyper J.M., Bolen J.B. (1990). Identification of a novel neuronal C-SRC exon expressed in human brain. Mol. Cell. Biol. 10: 2035—2040. PMID 1691439 DOI:10.1128/MCB.10.5.2035

Примітки

  1. Сполуки, які фізично взаємодіють з SRC proto-oncogene, non-receptor tyrosine kinase переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. (англ.) . Архів оригіналу за 29 квітня 2018. Процитовано 26 квітня 2018.
  5. (англ.) . Архів оригіналу за 29 квітня 2018. Процитовано 26 квітня 2018.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

Src angl SRC proto oncogene non receptor tyrosine kinase bilok yakij koduyetsya genom SRC roztashovanim u lyudini na dovgomu plechi 20 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 536 aminokislot a molekulyarna masa 59 835 SrcNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1A07 1A08 1A09 1A1A 1A1B 1A1C 1A1E 1FMK 1HCS 1HCT 1KSW 1O41 1O42 1O43 1O44 1O45 1O46 1O47 1O48 1O49 1O4A 1O4B 1O4C 1O4D 1O4E 1O4F 1O4G 1O4H 1O4I 1O4J 1O4K 1O4L 1O4M 1O4N 1O4O 1O4P 1O4Q 1O4R 1SHD 1Y57 1YI6 1YOJ 1YOL 1YOM 2BDF 2H8H 3VRO 3ZMP 3ZMQ 4F59 4F5A 4F5B 4HXJ 4K11 4MXO 4MXX 4MXY 4MXZIdentifikatoriSimvoliSRC ASV SRC1 c p60 Src SRC proto oncogene non receptor tyrosine kinase THC6Zovnishni ID OMIM 190090 MGI 98397 HomoloGene 21120 GeneCards SRC2 7 10 2Reaguye na spolukubozutinib Dazatinib saracatinib SU6656 saracatinib PD166285 Ontologiya genaMolekulyarna funkciya transmembrane transporter binding protein domain specific binding GO 0032403 protein containing complex binding SH2 domain binding kinase activity signaling receptor binding estrogen receptor binding ATP binding protein kinase activity insulin receptor binding non membrane spanning protein tyrosine kinase activity kinase binding heme binding enzyme binding transferase activity ephrin receptor binding scaffold protein binding integrin binding GO 0001948 GO 0016582 protein binding protein kinase binding cell adhesion molecule binding protein kinase C binding hormone receptor binding nucleotide binding growth factor receptor binding phosphoprotein binding protein tyrosine kinase activity protein C terminus binding ubiquitin protein ligase binding cadherin binding connexin binding phosphatidylinositol 4 5 bisphosphate 3 kinase activityKlitinna komponenta citoplazma gialoplazma membrana extrinsic component of cytoplasmic side of plasma membrane ruffle membrane mitohondriya perinuclear region of cytoplasm caveola neuron projection citoskelet klitinne yadro lizosoma ekzosoma late endosome klitinna membrana mikrofilament GO 0097483 GO 0097481 postsinaptichne ushilnennya mitohondrialna vnutrishnya membrana podosome nukleoplazma glutamatergic synapse postsynaptic specialization intracellular componentBiologichnij proces response to mineralocorticoid negative regulation of telomere maintenance via telomerase response to interleukin 1 positive regulation of MAP kinase activity positive regulation of canonical Wnt signaling pathway negative regulation of telomerase activity cellular response to progesterone stimulus regulation of intracellular estrogen receptor signaling pathway stress fiber assembly positive regulation of protein serine threonine kinase activity platelet activation positive regulation of smooth muscle cell migration protein phosphorylation regulation of vascular permeability vascular endothelial growth factor receptor signaling pathway positive regulation of ERK1 and ERK2 cascade regulation of podosome assembly klitinnij cikl substrate adhesion dependent cell spreading osteoclast development proliferaciya transforming growth factor beta receptor signaling pathway cellular response to hypoxia cellular response to transforming growth factor beta stimulus negative regulation of protein homooligomerization positive regulation of protein kinase B signaling positive regulation of lamellipodium morphogenesis epidermal growth factor receptor signaling pathway branching involved in mammary gland duct morphogenesis Fc gamma receptor signaling pathway involved in phagocytosis negative regulation of intrinsic apoptotic signaling pathway negative regulation of extrinsic apoptotic signaling pathway response to mechanical stimulus response to virus positive regulation of epithelial cell migration signal complex assembly stimulatory C type lectin receptor signaling pathway positive regulation of platelet derived growth factor receptor signaling pathway Oogenez GO 0060469 GO 0009371 positive regulation of transcription DNA templated regulation of epithelial cell migration response to nutrient levels positive regulation of DNA biosynthetic process cellular response to insulin stimulus protein autophosphorylation GO 0022415 viral process negative regulation of focal adhesion assembly response to acidic pH response to fatty acid regulation of cell projection assembly fosforilyuvannya proces imunnoyi sistemi negative regulation of mitochondrial depolarization positive regulation of integrin activation negative regulation of apoptotic process cellular response to platelet derived growth factor stimulus positive regulation of podosome assembly positive regulation of glucose metabolic process Citopempsis cellular response to fluid shear stress response to electrical stimulus positive regulation of protein transport uterus development protein destabilization regulation of cell cell adhesion peptidyl tyrosine autophosphorylation integrin mediated signaling pathway GO 1903106 positive regulation of insulin receptor signaling pathway progesterone receptor signaling pathway GO 0045996 negative regulation of transcription DNA templated adherens junction organization negative regulation of anoikis response to hydrogen peroxide leukocyte migration activation of protein kinase B activity negative regulation of cysteine type endopeptidase activity involved in apoptotic process GO 0007243 intracellular signal transduction regulation of early endosome to late endosome transport ephrin receptor signaling pathway T cell costimulation GO 0010740 positive regulation of intracellular signal transduction regulation of caveolin mediated endocytosis regulation of cell cycle positive regulation of phosphatidylinositol 3 kinase activity GO 0072353 cellular response to reactive oxygen species cellular response to peptide hormone stimulus GO 1901313 positive regulation of gene expression cellular response to fatty acid regulation of cell population proliferation angiotensin activated signaling pathway involved in heart process GO 0035404 peptidyl serine phosphorylation positive regulation of protein autophosphorylation positive regulation of cyclin dependent protein serine threonine kinase activity positive regulation of apoptotic process forebrain development regulation of protein binding cellular response to lipopolysaccharide regulation of bone resorption cell migration GO 0072468 signalna transdukciya positive regulation of cell adhesion adgeziya klitin positive regulation of protein processing vrodzhenij imunitet positive regulation of peptidyl tyrosine phosphorylation neurotrophin TRK receptor signaling pathway positive regulation of small GTPase mediated signal transduction kistkova rezorbciya central nervous system development positive regulation of protein localization to nucleus platelet derived growth factor receptor signaling pathway ERBB2 signaling pathway intracellular estrogen receptor signaling pathway axon guidance macroautophagy peptidyl tyrosine phosphorylation entry of bacterium into host cell cell cell adhesion primary ovarian follicle growth positive regulation of ovarian follicle development transmembrane receptor protein tyrosine kinase signaling pathway positive regulation of phosphatidylinositol 3 kinase signaling diferenciaciya klitin phosphatidylinositol phosphate biosynthetic process regulation of postsynaptic neurotransmitter receptor activity positive regulation of non membrane spanning protein tyrosine kinase activity G protein coupled receptor signaling pathway cellular response to hydrogen peroxide positive regulation of platelet derived growth factor receptor beta signaling pathway odontogenesisDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez6714 20779Ensembl ENSG00000197122 ENSMUSG00000027646UniProt P12931 P05480RefSeq mRNK NM 005417 NM 198291NM 001025395 NM 009271RefSeq bilok NP 005408 NP 938033NP 001020566 NP 033297Lokus UCSC Hr 20 37 34 37 41 MbHr 2 157 42 157 47 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGP SAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTE TDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEE WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGL NVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT SKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLL DFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGEN LVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWS FGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQ CWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do tirozinovih proteyinkinaz rodini Src proteyinkinaz Zadiyanij u takih biologichnih procesah yak klitinna adgeziya imunitet vzayemodiya hazyayin virus klitinnij cikl alternativnij splajsing Bilok ye lipoproteyinom maye sajt dlya zv yazuvannya z ATF Lokalizovanij u klitinnij membrani citoplazmi citoskeleti yadri vnutrishnij membrani mitohondriyi LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Anderson S K Gibbs C P Tanaka A Kung H J Fujita D J 1985 Human cellular src gene nucleotide sequence and derived amino acid sequence of the region coding for the carboxy terminal two thirds of pp60c src Mol Cell Biol 5 1122 1129 PMID 2582238 DOI 10 1128 MCB 5 5 1122 Pyper J M Bolen J B 1989 Neuron specific splicing of C SRC RNA in human brain J Neurosci Res 24 89 96 PMID 2681803 DOI 10 1002 jnr 490240113 Parker R C Mardon G Lebo R V Varmus H E Bishop J M 1985 Isolation of duplicated human c src genes located on chromosomes 1 and 20 Mol Cell Biol 5 831 838 PMID 2581127 DOI 10 1128 MCB 5 4 831 Cartwright C A Kamps M P Meisler A I Pipas J M Eckhart W 1989 pp60c src activation in human colon carcinoma J Clin Invest 83 2025 2033 PMID 2498394 DOI 10 1172 JCI114113 Pyper J M Bolen J B 1990 Identification of a novel neuronal C SRC exon expressed in human brain Mol Cell Biol 10 2035 2040 PMID 1691439 DOI 10 1128 MCB 10 5 2035PrimitkiSpoluki yaki fizichno vzayemodiyut z SRC proto oncogene non receptor tyrosine kinase pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 29 kvitnya 2018 Procitovano 26 kvitnya 2018 angl Arhiv originalu za 29 kvitnya 2018 Procitovano 26 kvitnya 2018 Div takozhHromosoma 20 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ