Підтримка
www.wikidata.uk-ua.nina.az
SIGMAR1 angl Sigma non opioid intracellular receptor 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 9 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 223 aminokislot a molekulyarna masa 25 128 SIGMAR1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB5HK1 5HK2IdentifikatoriSimvoliSIGMAR1 ALS16 OPRS1 SIG 1R SR BP SR BP1 SRBP hSigmaR1 sigma1R DSMA2 sigma non opioid intracellular receptor 1Zovnishni ID OMIM 601978 HomoloGene 39965 GeneCards SIGMAR1Pov yazani genetichni zahvoryuvannyaamyotrophic lateral sclerosis type 16 autosomal recessive distal spinal muscular atrophy 2 Reaguye na spolukudekstrometorfan PRE 084 bd 1047 Pentazocin Viroporin 3a pentoxyverine Ontologiya genaMolekulyarna funkciya G protein coupled opioid receptor activity identical protein binding signaling receptor activityKlitinna komponenta postsynaptic membrane cell projection endoplasmic reticulum membrane membrana growth cone lipid droplet klitinna membrana sinaps integral component of plasma membrane mizhklitinni kontakti nuclear inner membrane nuclear outer membrane klitinne yadro nuclear envelope endoplazmatichnij retikulum integral component of membrane GO 0016023 cytoplasmic vesicle GO 0097483 GO 0097481 postsinaptichne ushilnennyaBiologichnij proces lipid transport regulation of neuron apoptotic process nejrobiologiya rozvitku G protein coupled opioid receptor signaling pathway protein homotrimerization GO 0072468 signalna transdukciya cell death in response to hydrogen peroxideDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez10280 855242Ensembl ENSG00000147955 YMR202WUniProt Q99720 P32352RefSeq mRNK NM 001282205 NM 001282206 NM 001282207 NM 001282208 NM 001282209NM 005866 NM 147157 NM 147158 NM 147159 NM 147160NM 001182709RefSeq bilok NP 001269134 NP 001269135 NP 001269136 NP 001269137 NP 001269138NP 005857 NP 671513NP 013929Lokus UCSC Hr 9 34 63 34 64 Mbn dPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYA GLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASL SEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGE TVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLF YTLRSYARGLRLELTTYLFGQDP A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do receptoriv Zadiyanij u takih biologichnih procesah yak transport transport lipidiv alternativnij splajsing Lokalizovanij u klitinnij membrani yadri membrani klitinnih kontaktah endoplazmatichnomu retikulumi klitinnih vidrostkah citoplazmatichnih vezikulah lipidnih kraplyah sinapsah LiteraturaKekuda R Prasad P D Fei Y J Leibach F H Ganapathy V 1996 Cloning and functional expression of the human type 1 sigma receptor hSigmaR1 Biochem Biophys Res Commun 229 553 558 PMID 8954936 DOI 10 1006 bbrc 1996 1842 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Wang L Duncan G 2006 Silencing of sigma 1 receptor induces cell death in human lens cells Exp Cell Res 312 1439 1446 PMID 16472803 DOI 10 1016 j yexcr 2006 01 004 Ortega Roldan J L Ossa F Amin N T Schnell J R 2015 Solution NMR studies reveal the location of the second transmembrane domain of the human sigma 1 receptor FEBS Lett 589 659 665 PMID 25647032 DOI 10 1016 j febslet 2015 01 033 Satoh F Miyatake R Furukawa A Suwaki H 2004 Lack of association between sigma receptor gene variants and schizophrenia Psychiatry Clin Neurosci 58 359 363 PMID 15298647 DOI 10 1111 j 1440 1819 2004 01268 x Al Saif A Al Mohanna F Bohlega S 2011 A mutation in sigma 1 receptor causes juvenile amyotrophic lateral sclerosis Ann Neurol 70 913 919 PMID 21842496 DOI 10 1002 ana 22534PrimitkiZahvoryuvannya genetichno pov yazani z SIGMAR1 pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z SIGMAR1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 20 kvitnya 2017 Procitovano 8 veresnya 2017 angl Arhiv originalu za 13 veresnya 2017 Procitovano 8 veresnya 2017 Div takozhHromosoma 9 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi
Топ