Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

PPARGC1A англ PPARG coactivator 1 alpha білок який кодується однойменним геном розташованим у людей на короткому плечі 4

PPARGC1A

PPARGC1A

PPARGC1A (англ. PPARG coactivator 1 alpha) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. Довжина поліпептидного ланцюга білка становить 798 амінокислот, а молекулярна маса — 91 027.

PPARGC1A
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PPARGC1A, LEM6, PGC-1(alpha), PGC-1v, PGC1, PGC1A, PPARGC1, PGC-1alpha, PPARG coactivator 1 alpha, PGC-1α
Зовнішні ІД OMIM: 604517 MGI: 1342774 HomoloGene: 7485 GeneCards: PPARGC1A
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
10891
19017
Ensembl
ENSG00000109819
ENSMUSG00000029167
UniProt
Q9UBK2
O70343
RefSeq (мРНК)
NM_013261
NM_001330751
NM_001330752
NM_001330753
NM_008904
RefSeq (білок)
Локус (UCSC) н/д Хр. 5: 51.61 – 51.73 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS
FLGGLKWCSDQSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLP
VDEDGLPSFDALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLA
PANTQLSYNECSGLSTQNHANHNHRIRTNPAIVKTENSWSNKAKSICQQQ
KPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCTSKKKSHTQSQSQH
LQAKPTTLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTP
PHKANQDNPFRASPKLKSSCKTVVPPPSKKPRYSESSGTQGNNSTKKGPE
QSELYAQLSKSSVLTGGHEERKTKRPSLRLFGDHDYCQSINSKTEILINI
SQELQDSRQLENKDVSSDWQGQICSSTDSDQCYLRETLEASKQVSPCSTR
KQLQDQEIRAELNKHFGHPSQAVFDDEADKTGELRDSDFSNEQFSKLPMF
INSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFNVSPSCSSFNSPCRDS
VSPPKSLFSQRPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSC
YYYESSHYRHRTHRNSPLYVRSRSRSPYSRRPRYDSYEEYQHERLKREEY
RREYEKRESERAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVF
GEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYF
CGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, біологічні ритми, поліморфізм, ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з РНК. Локалізований у цитоплазмі, ядрі.

Література

  • Esterbauer H., Oberkofler H., Krempler F., Patsch W. (1999). Human peroxisome proliferator activated receptor gamma coactivator 1 (PPARGC1) gene: cDNA sequence, genomic organization, chromosomal localization, and tissue expression. Genomics. 62: 98—102. PMID 10585775 DOI:10.1006/geno.1999.5977
  • Larrouy D., Vidal H., Andreelli F., Laville M., Langin D. (1999). Cloning and mRNA tissue distribution of human PPARgamma coactivator-1. Int. J. Obes. Relat. Metab. Disord. 23: 1327—1332. PMID 10643692 DOI:10.1038/sj.ijo.0801106
  • Knutti D., Kaul A., Kralli A. (2000). A tissue-specific coactivator of steroid receptors, identified in a functional genetic screen. Mol. Cell. Biol. 20: 2411—2422. PMID 10713165 DOI:10.1128/MCB.20.7.2411-2422.2000
  • Dominy J.E. Jr., Lee Y., Gerhart-Hines Z., Puigserver P. (2010). Nutrient-dependent regulation of PGC-1alpha's acetylation state and metabolic function through the enzymatic activities of Sirt1/GCN5. Biochim. Biophys. Acta. 1804: 1676—1683. PMID 20005308 DOI:10.1016/j.bbapap.2009.11.023
  • Wei P., Pan D., Mao C., Wang Y.X. (2012). RNF34 is a cold-regulated E3 ubiquitin ligase for PGC-1alpha and modulates brown fat cell metabolism. Mol. Cell. Biol. 32: 266—275. PMID 22064484 DOI:10.1128/MCB.05674-11
  • Cho Y., Hazen B.C., Russell A.P., Kralli A. (2013). Peroxisome proliferator-activated receptor gamma coactivator 1 (PGC-1)- and estrogen-related receptor (ERR)-induced regulator in muscle 1 (Perm1) is a tissue-specific regulator of oxidative capacity in skeletal muscle cells. J. Biol. Chem. 288: 25207—25218. PMID 23836911 DOI:10.1074/jbc.M113.489674

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:9237 (англ.) . Процитовано 30 серпня 2017.
  4. (англ.) . Архів оригіналу за 16 серпня 2017. Процитовано 30 серпня 2017.

Див. також


image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

PPARGC1A angl PPARG coactivator 1 alpha bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 4 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 798 aminokislot a molekulyarna masa 91 027 PPARGC1ANayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1XB7 3B1M 3CS8 3D24 3U9Q 3V9T 3V9V 4QJR 4QK4IdentifikatoriSimvoliPPARGC1A LEM6 PGC 1 alpha PGC 1v PGC1 PGC1A PPARGC1 PGC 1alpha PPARG coactivator 1 alpha PGC 1aZovnishni ID OMIM 604517 MGI 1342774 HomoloGene 7485 GeneCards PPARGC1AOntologiya genaMolekulyarna funkciya promoter specific chromatin binding transcription factor binding chromatin binding GO 0001948 GO 0016582 protein binding nuclear receptor binding nucleic acid binding DNA binding sequence specific DNA binding GO 0001105 transcription coactivator activity alpha tubulin binding GO 0001104 transcription coregulator activity androgen receptor binding nuclear receptor coactivator activity RNA binding chromatin DNA binding ubiquitin protein ligase binding signaling receptor binding estrogen receptor binding peroxisome proliferator activated receptor bindingKlitinna komponenta citoplazma gialoplazma cytosolic ribosome klitinne yadro RNK polimeraza II apical dendrite neuronal cell body PML body nukleoplazma vnutrishnoklitinna membranna organelaBiologichnij proces GO 1904089 negative regulation of neuron apoptotic process response to dietary excess negative regulation of glycolytic process response to fructose cellular response to interleukin 6 ritmichnij proces cellular response to resveratrol response to thyroid hormone cellular response to fructose stimulus cellular response to ionomycin adaptive thermogenesis response to ischemia cirkadnij ritm fatty acid oxidation response to metformin cellular response to caffeine response to electrical stimulus involved in regulation of muscle adaptation temperature homeostasis cellular response to hypoxia cellular response to glucose stimulus positive regulation of fatty acid oxidation cellular response to transforming growth factor beta stimulus positive regulation of progesterone biosynthetic process GO 0009373 regulation of transcription DNA templated cellular response to follicle stimulating hormone stimulus androgen metabolic process GO 0001315 response to reactive oxygen species positive regulation of mitochondrial DNA metabolic process travlennya response to leucine response to norepinephrine response to epinephrine transcription DNA templated negative regulation of mitochondrial fission GO 0060469 GO 0009371 positive regulation of transcription DNA templated positive regulation of glomerular visceral epithelial cell apoptotic process response to nutrient levels Splajsing RNK skeletal muscle atrophy klitinne dihannya negative regulation of signaling receptor activity positive regulation of gluconeogenesis transcription initiation from RNA polymerase II promoter cellular response to potassium ion negative regulation of neuron death GO 0033128 negative regulation of protein phosphorylation positive regulation of cellular respiration mRNA processing protein stabilization mitochondrion organization positive regulation of DNA binding transcription factor activity response to electrical stimulus circadian regulation of gene expression cerebellum development positive regulation of ATP biosynthetic process regulation of NMDA receptor activity galactose metabolic process positive regulation of muscle tissue development regulation of circadian rhythm flavone metabolic process adipose tissue development respiratory electron transport chain positive regulation of cellular metabolic process response to muscle activity cellular response to nitrite positive regulation of smooth muscle cell proliferation glyukoneogenez androgen receptor signaling pathway negative regulation of smooth muscle cell proliferation response to hypoxia GO 1904578 response to organic cyclic compound cellular glucose homeostasis cellular response to tumor necrosis factor cellular response to estradiol stimulus GO 0010260 starinnya lyudini negative regulation of smooth muscle cell migration response to activity positive regulation of histone acetylation cellular response to fatty acid autophagy of mitochondrion cellular response to thyroid hormone stimulus response to methionine response to starvation response to cold cellular response to oxidative stress forebrain development cellular response to lipopolysaccharide GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II positive regulation of mitochondrion organization brown fat cell differentiation GO 0034622 protein containing complex assembly energy homeostasis GO 1901313 positive regulation of gene expression positive regulation of cold induced thermogenesisDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez10891 19017Ensembl ENSG00000109819 ENSMUSG00000029167UniProt Q9UBK2 O70343RefSeq mRNK NM 013261 NM 001330751 NM 001330752 NM 001330753NM 008904RefSeq bilok NP 001317680 NP 001317681 NP 001317682 NP 037393 NP 001341754NP 001341755 NP 001341756 NP 001341757NP 032930 NP 001389916 NP 001389917 NP 001389918 NP 001389919NP 001389920Lokus UCSC n dHr 5 51 61 51 73 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS FLGGLKWCSDQSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLP VDEDGLPSFDALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLA PANTQLSYNECSGLSTQNHANHNHRIRTNPAIVKTENSWSNKAKSICQQQ KPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCTSKKKSHTQSQSQH LQAKPTTLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTP PHKANQDNPFRASPKLKSSCKTVVPPPSKKPRYSESSGTQGNNSTKKGPE QSELYAQLSKSSVLTGGHEERKTKRPSLRLFGDHDYCQSINSKTEILINI SQELQDSRQLENKDVSSDWQGQICSSTDSDQCYLRETLEASKQVSPCSTR KQLQDQEIRAELNKHFGHPSQAVFDDEADKTGELRDSDFSNEQFSKLPMF INSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFNVSPSCSSFNSPCRDS VSPPKSLFSQRPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSC YYYESSHYRHRTHRNSPLYVRSRSRSPYSRRPRYDSYEEYQHERLKREEY RREYEKRESERAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVF GEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYF CGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do aktivatoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi biologichni ritmi polimorfizm acetilyaciya alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z RNK Lokalizovanij u citoplazmi yadri LiteraturaEsterbauer H Oberkofler H Krempler F Patsch W 1999 Human peroxisome proliferator activated receptor gamma coactivator 1 PPARGC1 gene cDNA sequence genomic organization chromosomal localization and tissue expression Genomics 62 98 102 PMID 10585775 DOI 10 1006 geno 1999 5977 Larrouy D Vidal H Andreelli F Laville M Langin D 1999 Cloning and mRNA tissue distribution of human PPARgamma coactivator 1 Int J Obes Relat Metab Disord 23 1327 1332 PMID 10643692 DOI 10 1038 sj ijo 0801106 Knutti D Kaul A Kralli A 2000 A tissue specific coactivator of steroid receptors identified in a functional genetic screen Mol Cell Biol 20 2411 2422 PMID 10713165 DOI 10 1128 MCB 20 7 2411 2422 2000 Dominy J E Jr Lee Y Gerhart Hines Z Puigserver P 2010 Nutrient dependent regulation of PGC 1alpha s acetylation state and metabolic function through the enzymatic activities of Sirt1 GCN5 Biochim Biophys Acta 1804 1676 1683 PMID 20005308 DOI 10 1016 j bbapap 2009 11 023 Wei P Pan D Mao C Wang Y X 2012 RNF34 is a cold regulated E3 ubiquitin ligase for PGC 1alpha and modulates brown fat cell metabolism Mol Cell Biol 32 266 275 PMID 22064484 DOI 10 1128 MCB 05674 11 Cho Y Hazen B C Russell A P Kralli A 2013 Peroxisome proliferator activated receptor gamma coactivator 1 PGC 1 and estrogen related receptor ERR induced regulator in muscle 1 Perm1 is a tissue specific regulator of oxidative capacity in skeletal muscle cells J Biol Chem 288 25207 25218 PMID 23836911 DOI 10 1074 jbc M113 489674PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 9237 angl Procitovano 30 serpnya 2017 angl Arhiv originalu za 16 serpnya 2017 Procitovano 30 serpnya 2017 Div takozhHromosoma 4 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ