PPARA angl Peroxisome proliferator activated receptor alpha bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 22 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 468 aminokislot a molekulyarna masa 52 225 PPARANayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1I7G 1K7L 1KKQ 2NPA 2P54 2REW 2ZNN 3ET1 3FEI 3G8I 3KDT 3KDU 3SP6 3VI8 4BCR 4CI4 5AZTIdentifikatoriSimvoliPPARA NR1C1 PPAR PPARalpha hPPAR peroxisome proliferator activated receptor alpha PPAR alphaZovnishni ID MGI 104740 HomoloGene 21047 GeneCards PPARAReaguye na spolukubezafibrate ciprofibrate clofibrate farglitazar fenofibrate gemfibrozil oleic monoethanolamide pirinixic acid Ontologiya genaMolekulyarna funkciya DNA binding sequence specific DNA binding protein domain specific binding GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity zinc ion binding GO 0001077 GO 0001212 GO 0001213 GO 0001211 GO 0001205 DNA binding transcription activator activity RNA polymerase II specific zv yazuvannya z ionom metalu GO 0000980 RNA polymerase II cis regulatory region sequence specific DNA binding steroid hormone receptor activity GO 0001078 GO 0001214 GO 0001206 DNA binding transcription repressor activity RNA polymerase II specific GO 0038050 GO 0004886 GO 0038051 nuclear receptor activity GO 0001948 GO 0016582 protein binding ubiquitin conjugating enzyme binding lipid binding transcription factor binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific signaling receptor activity GO 0032403 protein containing complex binding transcription coactivator binding phosphatase binding NFAT protein binding MDM2 MDM4 family protein binding GO 0000975 transcription cis regulatory region binding RNA polymerase II transcription regulatory region sequence specific DNA binding fatty acid binding nuclear receptor coactivator activityKlitinna komponenta klitinne yadro nukleoplazma RNA polymerase II transcription regulator complexBiologichnij proces lipoprotein metabolic process negative regulation of pri miRNA transcription by RNA polymerase II positive regulation of fatty acid beta oxidation negative regulation of glycolytic process response to hypoxia GO 0009373 regulation of transcription DNA templated negative regulation of blood pressure lipid metabolism ritmichnij proces Zagoyennya ran negative regulation of leukocyte cell cell adhesion GO 1901227 negative regulation of transcription by RNA polymerase II fatty acid transport negative regulation of protein binding negative regulation of appetite circadian regulation of gene expression transcription DNA templated fatty acid metabolic process behavioral response to nicotine GO 0060469 GO 0009371 positive regulation of transcription DNA templated negative regulation of cholesterol storage response to insulin heart development intracellular receptor signaling pathway negative regulation of transcription regulatory region DNA binding negative regulation of sequestering of triglyceride regulation of circadian rhythm regulation of fatty acid metabolic process epidermis development regulyaciya ekspresiyi geniv enamel mineralization positive regulation of gluconeogenesis transcription initiation from RNA polymerase II promoter negative regulation of inflammatory response negative regulation of macrophage derived foam cell differentiation GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II steroid hormone mediated signaling pathway negative regulation of neuron death positive regulation of fatty acid oxidation regulation of lipid metabolic process GO 0072468 signalna transdukciya multicellular organism development hormone mediated signaling pathway diferenciaciya klitin response to lipid GO 0045996 negative regulation of transcription DNA templated negative regulation of cell growth involved in cardiac muscle cell developmentDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5465 19013Ensembl ENSG00000186951 ENSMUSG00000022383UniProt Q07869 Q86SF0 P23204RefSeq mRNK NM 001001928 NM 001001929 NM 001001930 NM 005036 NM 032644NM 001362872 NM 001362873 NM 001393941 NM 001393942 NM 001393943 NM 001393944 NM 001393945 NM 001393946 NM 001393947NM 001113418 NM 011144RefSeq bilok NP 001001928 NP 005027 NP 001349801 NP 001349802NP 001106889 NP 035274Lokus UCSC Hr 22 46 15 46 24 MbHr 15 85 62 85 69 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFG FTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNI ECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNR NKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSET ADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMA EKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKP FCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKM QEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKT ESDAALHPLLQEIYRDMY A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv aktivatoriv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi biologichni ritmi alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z lipidami ionami metaliv ionom cinku DNK Lokalizovanij u yadri LiteraturaSher T Yi H F McBride O W Gonzales F J 1993 cDNA cloning chromosomal mapping and functional characterization of the human peroxisome proliferator activated receptor Biochemistry 32 5598 5604 PMID 7684926 DOI 10 1021 bi00072a015 Mukherjee R Jow L Noonan D McDonnell D P 1994 Human and rat peroxisome proliferator activated receptors PPARs demonstrate similar tissue distribution but different responsiveness to PPAR activators J Steroid Biochem Mol Biol 51 157 166 PMID 7981125 DOI 10 1016 0960 0760 94 90089 2 Tugwood J D Aldridge T C Lambe K G Macdonald N Woodyatt N J 1996 Peroxisome proliferator activated receptors structures and function Ann N Y Acad Sci 804 252 265 PMID 8993548 DOI 10 1111 j 1749 6632 1996 tb18620 x Kobayashi T Kodani Y Nozawa A Endo Y Sawasaki T 2008 DNA binding profiling of human hormone nuclear receptors via fluorescence correlation spectroscopy in a cell free system FEBS Lett 582 2737 2744 PMID 18619963 DOI 10 1016 j febslet 2008 07 003 Li H Gomes P J Chen J D 1997 RAC3 a steroid nuclear receptor associated coactivator that is related to SRC 1 and TIF2 Proc Natl Acad Sci U S A 94 8479 8484 PMID 9238002 DOI 10 1073 pnas 94 16 8479 Gorla Bajszczak A Juge Aubry C Pernin A Burger A G Meier C A 1999 Conserved amino acids in the ligand binding and tau i domains of the peroxisome proliferator activated receptor alpha are necessary for heterodimerization with RXR Mol Cell Endocrinol 147 37 47 PMID 10195690 DOI 10 1016 S0303 7207 98 00217 2PrimitkiSpoluki yaki fizichno vzayemodiyut z Peroxisome proliferator activated receptor alpha pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 16 bereznya 2016 Procitovano 12 veresnya 2017 angl Arhiv originalu za 23 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 22 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi