NR0B1 (англ. Nuclear receptor subfamily 0 group B member 1) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі. Довжина поліпептидного ланцюга білка становить 470 амінокислот, а молекулярна маса — 51 718.
NR0B1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | NR0B1, AHC, AHCH, AHX, DAX-1, DAX1, DSS, GTD, HHG, NROB1, SRXY2, nuclear receptor subfamily 0 group B member 1, Dax1 | ||||||||||||||||
Зовнішні ІД | OMIM: 300473 MGI: 1352460 HomoloGene: 403 GeneCards: NR0B1 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. X: 30.3 – 30.31 Mb | Хр. X: 85.24 – 85.24 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MAGENHQWQG | SILYNMLMSA | KQTRAAPEAP | ETRLVDQCWG | CSCGDEPGVG | ||||
REGLLGGRNV | ALLYRCCFCG | KDHPRQGSIL | YSMLTSAKQT | YAAPKAPEAT | ||||
LGPCWGCSCG | SDPGVGRAGL | PGGRPVALLY | RCCFCGEDHP | RQGSILYSLL | ||||
TSSKQTHVAP | AAPEARPGGA | WWDRSYFAQR | PGGKEALPGG | RATALLYRCC | ||||
FCGEDHPQQG | STLYCVPTST | NQAQAAPEER | PRAPWWDTSS | GALRPVALKS | ||||
PQVVCEAASA | GLLKTLRFVK | YLPCFQVLPL | DQQLVLVRNC | WASLLMLELA | ||||
QDRLQFETVE | VSEPSMLQKI | LTTRRRETGG | NEPLPVPTLQ | HHLAPPAEAR | ||||
KVPSASQVQA | IKCFLSKCWS | LNISTKEYAY | LKGTVLFNPD | VPGLQCVKYI | ||||
QGLQWGTQQI | LSEHTRMTHQ | GPHDRFIELN | STLFLLRFIN | ANVIAELFFR | ||||
PIIGTVSMDD | MMLEMLCTKI |
Кодований геном білок за функціями належить до репресорів, рецепторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Локалізований у цитоплазмі, ядрі.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Suzuki T., Kasahara M., Yoshioka H., Morohashi K., Umesono K. (2003). LXXLL-related motifs in Dax-1 have target specificity for the orphan nuclear receptors Ad4BP/SF-1 and LRH-1. Mol. Cell. Biol. 23: 238—249. PMID 12482977 DOI:10.1128/MCB.23.1.238-249.2003
- Ho J., Zhang Y.H., Huang B.L., McCabe E.R.B. (2004). NR0B1A: an alternatively spliced form of NR0B1. Mol. Genet. Metab. 83: 330—336. PMID 15589120 DOI:10.1016/j.ymgme.2004.10.002
- Niakan K.K., McCabe E.R.B. (2005). DAX1 origin, function, and novel role. Mol. Genet. Metab. 86: 70—83. PMID 16146703 DOI:10.1016/j.ymgme.2005.07.019
- Iyer A.K., Zhang Y.-H., McCabe E.R.B. (2006). Dosage-sensitive sex reversal adrenal hypoplasia congenita critical region on the X chromosome, gene 1 (DAX1) (NR0B1) and small heterodimer partner (SHP) (NR0B2) form homodimers individually, as well as DAX1-SHP heterodimers. Mol. Endocrinol. 20: 2326—2342. PMID 16709599 DOI:10.1210/me.2005-0383
- Schwartz M., Blichfeldt S., Mueller J. (1997). X-linked adrenal hypoplasia in a large Greenlandic family. Detection of a missense mutation (N4401) in the DAX-1 gene; implication for genetic counselling and carrier diagnosis. Hum. Genet. 99: 83—87. PMID 9003500 DOI:10.1007/s004390050316
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:7960 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 20 жовтня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
NR0B1 angl Nuclear receptor subfamily 0 group B member 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na X hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 470 aminokislot a molekulyarna masa 51 718 NR0B1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB4RWVIdentifikatoriSimvoliNR0B1 AHC AHCH AHX DAX 1 DAX1 DSS GTD HHG NROB1 SRXY2 nuclear receptor subfamily 0 group B member 1 Dax1Zovnishni ID OMIM 300473 MGI 1352460 HomoloGene 403 GeneCards NR0B1Ontologiya genaMolekulyarna funkciya protein domain specific binding sequence specific DNA binding protein homodimerization activity RNA binding GO 0038050 GO 0004886 GO 0038051 nuclear receptor activity AF 2 domain binding DNA binding DNA hairpin binding steroid hormone receptor activity GO 0001948 GO 0016582 protein binding GO 0001106 transcription corepressor activity transcription factor binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specificKlitinna komponenta citoplazma klitinne yadro membrana polysomal ribosome nukleoplazma centr organizaciyi mikrotrubochok nuclear speck vnutrishnoklitinna membranna organelaBiologichnij proces Determinaciya stati Spermatogenez negative regulation of DNA binding transcription factor activity transcription DNA templated response to immobilization stress pituitary gland development gonad development Leydig cell differentiation steroid hormone mediated signaling pathway transcription initiation from RNA polymerase II promoter GO 0034613 protein localization hypothalamus development negative regulation of cell differentiation male sex determination Sertoli cell differentiation negative regulation of intracellular steroid hormone receptor signaling pathway GO 0009373 regulation of transcription DNA templated diferenciaciya klitin steroid biosynthetic process male gonad development adrenal gland development GO 0045996 negative regulation of transcription DNA templated intracellular receptor signaling pathway GO 1901227 negative regulation of transcription by RNA polymerase IIDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez190 11614Ensembl ENSG00000169297 ENSMUSG00000025056UniProt P51843 Q61066RefSeq mRNK NM 000475NM 007430RefSeq bilok NP 000466 NP 000466 2NP 031456Lokus UCSC Hr X 30 3 30 31 MbHr X 85 24 85 24 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVG REGLLGGRNVALLYRCCFCGKDHPRQGSILYSMLTSAKQTYAAPKAPEAT LGPCWGCSCGSDPGVGRAGLPGGRPVALLYRCCFCGEDHPRQGSILYSLL TSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRATALLYRCC FCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSSGALRPVALKS PQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELA QDRLQFETVEVSEPSMLQKILTTRRRETGGNEPLPVPTLQHHLAPPAEAR KVPSASQVQAIKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYI QGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFR PIIGTVSMDDMMLEMLCTKI A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do represoriv receptoriv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi alternativnij splajsing Lokalizovanij u citoplazmi yadri LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Suzuki T Kasahara M Yoshioka H Morohashi K Umesono K 2003 LXXLL related motifs in Dax 1 have target specificity for the orphan nuclear receptors Ad4BP SF 1 and LRH 1 Mol Cell Biol 23 238 249 PMID 12482977 DOI 10 1128 MCB 23 1 238 249 2003 Ho J Zhang Y H Huang B L McCabe E R B 2004 NR0B1A an alternatively spliced form of NR0B1 Mol Genet Metab 83 330 336 PMID 15589120 DOI 10 1016 j ymgme 2004 10 002 Niakan K K McCabe E R B 2005 DAX1 origin function and novel role Mol Genet Metab 86 70 83 PMID 16146703 DOI 10 1016 j ymgme 2005 07 019 Iyer A K Zhang Y H McCabe E R B 2006 Dosage sensitive sex reversal adrenal hypoplasia congenita critical region on the X chromosome gene 1 DAX1 NR0B1 and small heterodimer partner SHP NR0B2 form homodimers individually as well as DAX1 SHP heterodimers Mol Endocrinol 20 2326 2342 PMID 16709599 DOI 10 1210 me 2005 0383 Schwartz M Blichfeldt S Mueller J 1997 X linked adrenal hypoplasia in a large Greenlandic family Detection of a missense mutation N4401 in the DAX 1 gene implication for genetic counselling and carrier diagnosis Hum Genet 99 83 87 PMID 9003500 DOI 10 1007 s004390050316PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 7960 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 20 zhovtnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma X Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi