MPG (англ. N-methylpurine DNA glycosylase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми. Довжина поліпептидного ланцюга білка становить 298 амінокислот, а молекулярна маса — 32 869.
MPG | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | MPG, AAG, ADPG, APNG, CRA36.1, MDG, Mid1, PIG11, PIG16, anpg, N-methylpurine DNA glycosylase | ||||||||||||||||
Зовнішні ІД | OMIM: 156565 MGI: 97073 HomoloGene: 1824 GeneCards: MPG | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 16: 0.08 – 0.09 Mb | Хр. 11: 32.18 – 32.18 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MVTPALQMKK | PKQFCRRMGQ | KKQRPARAGQ | PHSSSDAAQA | PAEQPHSSSD | ||||
AAQAPCPRER | CLGPPTTPGP | YRSIYFSSPK | GHLTRLGLEF | FDQPAVPLAR | ||||
AFLGQVLVRR | LPNGTELRGR | IVETEAYLGP | EDEAAHSRGG | RQTPRNRGMF | ||||
MKPGTLYVYI | IYGMYFCMNI | SSQGDGACVL | LRALEPLEGL | ETMRQLRSTL | ||||
RKGTASRVLK | DRELCSGPSK | LCQALAINKS | FDQRDLAQDE | AVWLERGPLE | ||||
PSEPAVVAAA | RVGVGHAGEW | ARKPLRFYVR | GSPWVSVVDR | VAEQDTQA |
Кодований геном білок за функціями належить до гідролаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як пошкодження ДНК, репарація ДНК, альтернативний сплайсинг. Локалізований у цитоплазмі, ядрі, мітохондрії, мітохондріальному нуклеоїді.
Література
- Samson L., Derfler B., Boosalis M., Call K. (1991). Cloning and characterization of a 3-methyladenine DNA glycosylase cDNA from human cells whose gene maps to chromosome 16. Proc. Natl. Acad. Sci. U.S.A. 88: 9127—9131. PMID 1924375 DOI:10.1073/pnas.88.20.9127
- Vickers M.A., Vyas P., Harris P.C., Simmons D.L., Higgs D.R. (1993). Structure of the human 3-methyladenine DNA glycosylase gene and localization close to the 16p telomere. Proc. Natl. Acad. Sci. U.S.A. 90: 3437—3441. PMID 8475094 DOI:10.1073/pnas.90.8.3437
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- O'Connor T.R., Laval J. (1991). Human cDNA expressing a functional DNA glycosylase excising 3-methyladenine and 7-methylguanine. Biochem. Biophys. Res. Commun. 176: 1170—1177. PMID 1645538 DOI:10.1016/0006-291X(91)90408-Y
- Kielman M.F., Smits R., Devi T.S., Fodde R., Bernini L.F. (1993). Homology of a 130-kb region enclosing the alpha-globin gene cluster, the alpha-locus controlling region, and two non-globin genes in human and mouse. Mamm. Genome. 4: 314—323. PMID 8318735 DOI:10.1007/BF00357090
- van Loon B., Samson L.D. (2013). Alkyladenine DNA glycosylase (AAG) localizes to mitochondria and interacts with mitochondrial single-stranded binding protein (mtSSB). DNA Repair. 12: 177—187. PMID 23290262 DOI:10.1016/j.dnarep.2012.11.009
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:7211 (англ.) . Процитовано 11 вересня 2017.
{{}}
: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url () - UniProt, P29372 (англ.) . Архів оригіналу за 7 жовтня 2017. Процитовано 11 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
MPG angl N methylpurine DNA glycosylase bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 16 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 298 aminokislot a molekulyarna masa 32 869 4 MPGNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1BNK 1EWN 1F4R 1F6O 3QI5 3UBYIdentifikatoriSimvoliMPG AAG ADPG APNG CRA36 1 MDG Mid1 PIG11 PIG16 anpg N methylpurine DNA glycosylaseZovnishni ID OMIM 156565 MGI 97073 HomoloGene 1824 GeneCards MPGOntologiya genaMolekulyarna funkciya DNA 7 methylguanine glycosylase activity DNA 7 methyladenine glycosylase activity damaged DNA binding DNA binding alkylbase DNA N glycosylase activity GO 0001948 GO 0016582 protein binding DNA 3 methylguanine glycosylase activity katalitichna aktivnist hydrolase activity DNA 3 methyladenine glycosylase activity DNA N glycosylase activityKlitinna komponenta citoplazma mitochondrial nucleoid mitohondriya klitinne yadro nukleoplazmaBiologichnij proces depurination DNA dealkylation involved in DNA repair base excision repair cellular response to DNA damage stimulus GO 0100026 Reparaciya DNKDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez4350 268395Ensembl ENSG00000103152 ENSMUSG00000020287UniProt P29372 Q04841RefSeq mRNK NM 002434 NM 001015052 NM 001015054NM 010822RefSeq bilok NP 001015052 NP 001015054 NP 002425NP 034952Lokus UCSC Hr 16 0 08 0 09 MbHr 11 32 18 32 18 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MVTPALQMKKPKQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSD AAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPAVPLAR AFLGQVLVRRLPNGTELRGRIVETEAYLGPEDEAAHSRGGRQTPRNRGMF MKPGTLYVYIIYGMYFCMNISSQGDGACVLLRALEPLEGLETMRQLRSTL RKGTASRVLKDRELCSGPSKLCQALAINKSFDQRDLAQDEAVWLERGPLE PSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do gidrolaz fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak poshkodzhennya DNK reparaciya DNK alternativnij splajsing Lokalizovanij u citoplazmi yadri mitohondriyi mitohondrialnomu nukleoyidi Literaturared Samson L Derfler B Boosalis M Call K 1991 Cloning and characterization of a 3 methyladenine DNA glycosylase cDNA from human cells whose gene maps to chromosome 16 Proc Natl Acad Sci U S A 88 9127 9131 PMID 1924375 DOI 10 1073 pnas 88 20 9127 Vickers M A Vyas P Harris P C Simmons D L Higgs D R 1993 Structure of the human 3 methyladenine DNA glycosylase gene and localization close to the 16p telomere Proc Natl Acad Sci U S A 90 3437 3441 PMID 8475094 DOI 10 1073 pnas 90 8 3437 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 O Connor T R Laval J 1991 Human cDNA expressing a functional DNA glycosylase excising 3 methyladenine and 7 methylguanine Biochem Biophys Res Commun 176 1170 1177 PMID 1645538 DOI 10 1016 0006 291X 91 90408 Y Kielman M F Smits R Devi T S Fodde R Bernini L F 1993 Homology of a 130 kb region enclosing the alpha globin gene cluster the alpha locus controlling region and two non globin genes in human and mouse Mamm Genome 4 314 323 PMID 8318735 DOI 10 1007 BF00357090 van Loon B Samson L D 2013 Alkyladenine DNA glycosylase AAG localizes to mitochondria and interacts with mitochondrial single stranded binding protein mtSSB DNA Repair 12 177 187 PMID 23290262 DOI 10 1016 j dnarep 2012 11 009Primitkired Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 7211 angl Procitovano 11 veresnya 2017 a href wiki D0 A8 D0 B0 D0 B1 D0 BB D0 BE D0 BD Cite web title Shablon Cite web cite web a Obslugovuvannya CS1 Storinki z parametrom url status ale bez parametra archive url posilannya UniProt P29372 angl Arhiv originalu za 7 zhovtnya 2017 Procitovano 11 veresnya 2017 Div takozhred Hromosoma 16 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title MPG amp oldid 43438815