MDK (англ. Midkine (neurite growth-promoting factor 2)) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми. Довжина поліпептидного ланцюга білка становить 143 амінокислот, а молекулярна маса — 15 585.
MDK | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | MDK, ARAP, MK, NEGF2, midkine (neurite growth-promoting factor 2), midkine | ||||||||||||||||
Зовнішні ІД | OMIM: 162096 MGI: 96949 HomoloGene: 1792 GeneCards: MDK | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 11: 46.38 – 46.38 Mb | Хр. 2: 91.76 – 91.76 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MQHRGFLLLT | LLALLALTSA | VAKKKDKVKK | GGPGSECAEW | AWGPCTPSSK | ||||
DCGVGFREGT | CGAQTQRIRC | RVPCNWKKEF | GADCKYKFEN | WGACDGGTGT | ||||
KVRQGTLKKA | RYNAQCQETI | RVTKPCTPKT | KAKAKAKKGK | GKD |
Кодований геном білок за функціями належить до факторів росту, мітогенів, . Задіяний у таких біологічних процесах, як диференціація клітин, альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою гепарину. Секретований назовні.
Література
- Tsutsui J., Uehara K., Kadomatsu K., Matsubara S., Muramatsu T. (1991). A new family of heparin-binding factors: strong conservation of midkine (MK) sequences between the human and the mouse. Biochem. Biophys. Res. Commun. 176: 792—797. PMID 2025291 DOI:10.1016/S0006-291X(05)80255-4
- Fairhurst J.L., Kretschmer P.J., Gluzman Y., Boehlen P., Kovesdi I. (1993). Structure of the gene coding for the human retinoic acid-inducible factor, MK. DNA Cell Biol. 12: 139—147. PMID 8471163 DOI:10.1089/dna.1993.12.139
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 13: 2819—2824. PMID 15340161 DOI:10.1110/ps.04682504
- Uehara K., Matsubara S., Kadomatsu K., Tsutsui J., Muramatsu T. (1992). Genomic structure of human midkine (MK), a retinoic acid-responsive growth/differentiation factor. J. Biochem. 111: 563—567. PMID 1639750
- Novotny W.F., Maffi T., Mehta R.L., Milner P.G. (1993). Identification of novel heparin-releasable proteins, as well as the cytokines midkine and pleiotrophin, in human postheparin plasma. Arterioscler. Thromb. 13: 1798—1805. PMID 8241100
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:6972 (англ.) . Процитовано 8 вересня 2017.
- (англ.) . Архів оригіналу за 11 вересня 2017. Процитовано 8 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
MDK angl Midkine neurite growth promoting factor 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 11 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 143 aminokislot a molekulyarna masa 15 585 MDKNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1MKC 1MKNIdentifikatoriSimvoliMDK ARAP MK NEGF2 midkine neurite growth promoting factor 2 midkineZovnishni ID OMIM 162096 MGI 96949 HomoloGene 1792 GeneCards MDKOntologiya genaMolekulyarna funkciya growth factor activity heparin bindingKlitinna komponenta citoplazma cell projection extracellular region collagen containing extracellular matrixBiologichnij proces Signalnij shlyah Notch GO 1904089 negative regulation of neuron apoptotic process regulation of behavior cerebellar granular layer development dentate gyrus development response to glucocorticoid behavioral fear response nejrobiologiya rozvitku GO 0060469 GO 0009371 positive regulation of transcription DNA templated multicellular organism development defekaciya korotkochasna pam yat cerebral cortex development response to hormone cell migration hippocampus development positive regulation of cell division GO 0072468 signalna transdukciya negative regulation of neuron death response to wounding adrenal gland development diferenciaciya klitin regulation of signaling receptor activityDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez4192 17242Ensembl ENSG00000110492 ENSMUSG00000027239UniProt P21741 P12025RefSeq mRNK NM 001012333 NM 001012334 NM 001270550 NM 001270551 NM 001270552NM 002391NM 001012335 NM 001012336 NM 010784 NM 001291481 NM 001291482NM 001291483RefSeq bilok NP 001012333 NP 001012334 NP 001257479 NP 001257480 NP 001257481NP 002382NP 001012335 NP 001012336 NP 001278410 NP 001278411 NP 001278412NP 034914Lokus UCSC Hr 11 46 38 46 38 MbHr 2 91 76 91 76 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSK DCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGT KVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do faktoriv rostu mitogeniv Zadiyanij u takih biologichnih procesah yak diferenciaciya klitin alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z molekuloyu geparinu Sekretovanij nazovni LiteraturaTsutsui J Uehara K Kadomatsu K Matsubara S Muramatsu T 1991 A new family of heparin binding factors strong conservation of midkine MK sequences between the human and the mouse Biochem Biophys Res Commun 176 792 797 PMID 2025291 DOI 10 1016 S0006 291X 05 80255 4 Fairhurst J L Kretschmer P J Gluzman Y Boehlen P Kovesdi I 1993 Structure of the gene coding for the human retinoic acid inducible factor MK DNA Cell Biol 12 139 147 PMID 8471163 DOI 10 1089 dna 1993 12 139 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Zhang Z Henzel W J 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites Protein Sci 13 2819 2824 PMID 15340161 DOI 10 1110 ps 04682504 Uehara K Matsubara S Kadomatsu K Tsutsui J Muramatsu T 1992 Genomic structure of human midkine MK a retinoic acid responsive growth differentiation factor J Biochem 111 563 567 PMID 1639750 Novotny W F Maffi T Mehta R L Milner P G 1993 Identification of novel heparin releasable proteins as well as the cytokines midkine and pleiotrophin in human postheparin plasma Arterioscler Thromb 13 1798 1805 PMID 8241100PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 6972 angl Procitovano 8 veresnya 2017 angl Arhiv originalu za 11 veresnya 2017 Procitovano 8 veresnya 2017 Div takozhHromosoma 11 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi