MAPK11 (англ. Mitogen-activated protein kinase 11) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми. Довжина поліпептидного ланцюга білка становить 364 амінокислот, а молекулярна маса — 41 357.
MAPK11 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | MAPK11, P38B, P38BETA2, PRKM11, SAPK2, SAPK2B, p38-2, p38Beta, mitogen-activated protein kinase 11 | ||||||||||||||||
Зовнішні ІД | OMIM: 602898 MGI: 1338024 HomoloGene: 55684 GeneCards: MAPK11 | ||||||||||||||||
Реагує на сполуку | |||||||||||||||||
SB-203580 | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 22: 50.26 – 50.27 Mb | Хр. 15: 89.03 – 89.03 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MSGPRAGFYR | QELNKTVWEV | PQRLQGLRPV | GSGAYGSVCS | AYDARLRQKV | ||||
AVKKLSRPFQ | SLIHARRTYR | ELRLLKHLKH | ENVIGLLDVF | TPATSIEDFS | ||||
EVYLVTTLMG | ADLNNIVKCQ | ALSDEHVQFL | VYQLLRGLKY | IHSAGIIHRD | ||||
LKPSNVAVNE | DCELRILDFG | LARQADEEMT | GYVATRWYRA | PEIMLNWMHY | ||||
NQTVDIWSVG | CIMAELLQGK | ALFPGSDYID | QLKRIMEVVG | TPSPEVLAKI | ||||
SSEHARTYIQ | SLPPMPQKDL | SSIFRGANPL | AIDLLGRMLV | LDSDQRVSAA | ||||
EALAHAYFSQ | YHDPEDEPEA | EPYDESVEAK | ERTLEEWKEL | TYQEVLSFKP | ||||
PEPPKPPGSL | EIEQ |
Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ, фосфопротеїнів. Задіяний у таких біологічних процесах, як відповідь на стрес, транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, ядрі.
Література
- Enslen H., Raingeaud J., Davis R.J. (1998). Selective activation of p38 mitogen-activated protein (MAP) kinase isoforms by the MAP kinase kinases MKK3 and MKK6. J. Biol. Chem. 273: 1741—1748. PMID 9430721 DOI:10.1074/jbc.273.3.1741
- Goedert M., Cuenda A., Craxton M., Jakes R., Cohen P. (1997). Activation of the novel stress-activated protein kinase SAPK4 by cytokines and cellular stresses is mediated by SKK3 (MKK6); comparison of its substrate specificity with that of other SAP kinases. EMBO J. 16: 3563—3571. PMID 9218798 DOI:10.1093/emboj/16.12.3563
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Deak M., Clifton A.D., Lucocq J.M., Alessi D.R. (1998). Mitogen- and stress-activated protein kinase-1 (MSK1) is directly activated by MAPK and SAPK2/p38, and may mediate activation of CREB. EMBO J. 17: 4426—4441. PMID 9687510 DOI:10.1093/emboj/17.15.4426
- Yang S.-H., Galanis A., Sharrocks A.D. (1999). Targeting of p38 mitogen-activated protein kinases to MEF2 transcription factors. Mol. Cell. Biol. 19: 4028—4038. PMID 10330143 DOI:10.1128/MCB.19.6.4028
- Tanoue T., Yamamoto T., Maeda R., Nishida E. (2001). A Novel MAPK phosphatase MKP-7 acts preferentially on JNK/SAPK and p38 alpha and beta MAPKs. J. Biol. Chem. 276: 26629—26639. PMID 11359773 DOI:10.1074/jbc.M101981200
Примітки
- Сполуки, які фізично взаємодіють з mitogen-activated protein kinase 11 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:6873 (англ.) . Архів оригіналу за 28 травня 2017. Процитовано 12 вересня 2017. [Архівовано 2017-05-28 у Wayback Machine.]
- UniProt, Q15759 (англ.) . Архів оригіналу за 1 вересня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
MAPK11 angl Mitogen activated protein kinase 11 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 22 yi hromosomi 4 Dovzhina polipeptidnogo lancyuga bilka stanovit 364 aminokislot a molekulyarna masa 41 357 5 MAPK11Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB3GC8 3GC9 3GP0IdentifikatoriSimvoliMAPK11 P38B P38BETA2 PRKM11 SAPK2 SAPK2B p38 2 p38Beta mitogen activated protein kinase 11Zovnishni ID OMIM 602898 MGI 1338024 HomoloGene 55684 GeneCards MAPK11Reaguye na spolukuSB 203580 1 Ontologiya genaMolekulyarna funkciya transferase activity nucleotide binding protein kinase activity MAP kinase activity kinase activity protein serine threonine kinase activity GO 0001948 GO 0016582 protein binding ATP bindingKlitinna komponenta gialoplazma nukleoplazma klitinne yadro citoplazmaBiologichnij proces GO 0009373 regulation of transcription DNA templated regulation of cardiac muscle cell proliferation positive regulation of erythrocyte differentiation fosforilyuvannya positive regulation of muscle cell differentiation transcription DNA templated protein phosphorylation GO 1901313 positive regulation of gene expression negative regulation of cardiac muscle cell proliferation regulation of signal transduction by p53 class mediator stress activated MAPK cascade cellular response to interleukin 1 regulyaciya ekspresiyi geniv GO 0007243 intracellular signal transduction cellular response to organic substance Ras protein signal transduction vascular endothelial growth factor receptor signaling pathway regulation of DNA binding transcription factor activityDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5600 19094Ensembl ENSG00000185386 ENSMUSG00000053137UniProt Q15759 Q9WUI1RefSeq mRNK NM 002751NM 011161RefSeq bilok NP 002742NP 035291Lokus UCSC Hr 22 50 26 50 27 MbHr 15 89 03 89 03 MbPubMed search 2 3 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKV AVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFS EVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRD LKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHY NQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKI SSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKP PEPPKPPGSLEIEQ A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do transferaz kinaz serin treoninovih proteyinkinaz fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak vidpovid na stres transkripciya regulyaciya transkripciyi alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ATF nukleotidami Lokalizovanij u citoplazmi yadri Literaturared Enslen H Raingeaud J Davis R J 1998 Selective activation of p38 mitogen activated protein MAP kinase isoforms by the MAP kinase kinases MKK3 and MKK6 J Biol Chem 273 1741 1748 PMID 9430721 DOI 10 1074 jbc 273 3 1741 Goedert M Cuenda A Craxton M Jakes R Cohen P 1997 Activation of the novel stress activated protein kinase SAPK4 by cytokines and cellular stresses is mediated by SKK3 MKK6 comparison of its substrate specificity with that of other SAP kinases EMBO J 16 3563 3571 PMID 9218798 DOI 10 1093 emboj 16 12 3563 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Deak M Clifton A D Lucocq J M Alessi D R 1998 Mitogen and stress activated protein kinase 1 MSK1 is directly activated by MAPK and SAPK2 p38 and may mediate activation of CREB EMBO J 17 4426 4441 PMID 9687510 DOI 10 1093 emboj 17 15 4426 Yang S H Galanis A Sharrocks A D 1999 Targeting of p38 mitogen activated protein kinases to MEF2 transcription factors Mol Cell Biol 19 4028 4038 PMID 10330143 DOI 10 1128 MCB 19 6 4028 Tanoue T Yamamoto T Maeda R Nishida E 2001 A Novel MAPK phosphatase MKP 7 acts preferentially on JNK SAPK and p38 alpha and beta MAPKs J Biol Chem 276 26629 26639 PMID 11359773 DOI 10 1074 jbc M101981200Primitkired Spoluki yaki fizichno vzayemodiyut z mitogen activated protein kinase 11 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 6873 angl Arhiv originalu za 28 travnya 2017 Procitovano 12 veresnya 2017 Arhivovano 2017 05 28 u Wayback Machine UniProt Q15759 angl Arhiv originalu za 1 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhred Hromosoma 22 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title MAPK11 amp oldid 44011593