Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

HTR1D англ 5 hydroxytryptamine receptor 1D білок який кодується однойменним геном розташованим у людей на короткому плеч

HTR1D

HTR1D

HTR1D (англ. 5-hydroxytryptamine receptor 1D) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 377 амінокислот, а молекулярна маса — 41 907.

HTR1D
Ідентифікатори
Символи HTR1D, 5-HT1D, HT1DA, HTR1DA, HTRL, RDC4, 5-HT1D receptor, 5-hydroxytryptamine receptor 1D
Зовнішні ІД OMIM: 182133 MGI: 96276 HomoloGene: 20240 GeneCards: HTR1D
Реагує на сполуку
ерготамін, frovatriptan, 1-naphthylpiperazine, 2-methyl-5-HT, 5-carboxamidotryptamine, Серотонін, 5-methoxytryptamine, (+/-)-8-hydroxy-2-(di-N-propylamino)tetralin, alniditan, α-methyl-5-HT, арипіпразол, CGS-12066A, клозапін, CP-122288, дігідроертотамін, диметилтриптамін, donitriptan, елетріптан, EMDT, lysergic acid, lysergol, наратріптан, оланзапін, кветіапін, різатріптан, ru-24969, суматріптан, 1-(3-trifluoromethylphenyl)piperazine, триптамін, xanomeline, зипразидон, золмітріптан, brl-15572, бромокриптин, каберголін, gr-127935, lisuride, оксиметазолін, pergolide, roxindole, sb-216641, terguride, bufotenine, cyanopindolol, fluspirilene, галоперидол, m-chlorophenylpiperazine, ketanserin, metergoline, methysergide, ocaperidone, pipamperone, α-yohimbine, рисперидон, ritanserin, SB-277,011-A, сертиндол, spiperone, yohimbine, zotepine, metitepine, sumatriptan succinate, donitriptan, zimeldine, різатріптан, золмітріптан, naratriptan hydrochloride
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
3352
15552
Ensembl
ENSG00000179546
ENSMUSG00000070687
UniProt
P28221
Q61224
RefSeq (мРНК)
NM_000864
NM_001285482
NM_001285483
NM_001285484
NM_008309
RefSeq (білок)
NP_000855
NP_001272411
NP_001272412
NP_001272413
NP_032335
Локус (UCSC) Хр. 1: 23.19 – 23.22 Mb Хр. 4: 136.15 – 136.17 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITL
ATVLSNAFVLTTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTI
THTWNFGQILCDIWLSSDITCCTASILHLCVIALDRYWAITDALEYSKRR
TAGHAATMIAIVWAISICISIPPLFWRQAKAQEEMSDCLVNTSQISYTIY
STCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAG
SSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSL
INPIIYTVFNEEFRQAFQKIVPFRKAS

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, . Задіяний у такому біологічному процесі як поліморфізм. Локалізований у клітинній мембрані, мембрані.

Література

  • Weinshank R.L., Zgombick J.M., Macchi M.J., Branchek T.A., Hartig P.R. (1992). Human serotonin 1D receptor is encoded by a subfamily of two distinct genes: 5-HT1D alpha and 5-HT1D beta. Proc. Natl. Acad. Sci. U.S.A. 89: 3630—3634. PMID 1565658 DOI:10.1073/pnas.89.8.3630
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Gonzalez-Heydrich J., Peroutka S.J. (1991). Postsynaptic localization of 5-HT1D receptor binding sites in human caudate. Exp. Neurol. 113: 28—30. PMID 1828434 DOI:10.1016/0014-4886(91)90142-Y
  • Xie Z., Lee S.P., O'Dowd B.F., George S.R. (1999). Serotonin 5-HT1B and 5-HT1D receptors form homodimers when expressed alone and heterodimers when co-expressed. FEBS Lett. 456: 63—67. PMID 10452531 DOI:10.1016/S0014-5793(99)00918-7
  • Nichols D.E., Nichols C.D. (2008). Serotonin receptors. Chem. Rev. 108: 1614—1641. PMID 18476671 DOI:10.1021/cr078224o
  • Hamblin M.W., Metcalf M.A. (1991). Primary structure and functional characterization of a human 5-HT1D-type serotonin receptor. Mol. Pharmacol. 40: 143—148. PMID 1652050

Примітки

  1. Сполуки, які фізично взаємодіють з 5-hydroxytryptamine receptor 1D переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:5289 (англ.) . Процитовано 25 серпня 2017.
  5. (англ.) . Архів оригіналу за 16 серпня 2017. Процитовано 25 серпня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

HTR1D angl 5 hydroxytryptamine receptor 1D bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 377 aminokislot a molekulyarna masa 41 907 HTR1DIdentifikatoriSimvoliHTR1D 5 HT1D HT1DA HTR1DA HTRL RDC4 5 HT1D receptor 5 hydroxytryptamine receptor 1DZovnishni ID OMIM 182133 MGI 96276 HomoloGene 20240 GeneCards HTR1DReaguye na spolukuergotamin frovatriptan 1 naphthylpiperazine 2 methyl 5 HT 5 carboxamidotryptamine Serotonin 5 methoxytryptamine 8 hydroxy 2 di N propylamino tetralin alniditan a methyl 5 HT aripiprazol CGS 12066A klozapin CP 122288 digidroertotamin dimetiltriptamin donitriptan eletriptan EMDT lysergic acid lysergol naratriptan olanzapin kvetiapin rizatriptan ru 24969 sumatriptan 1 3 trifluoromethylphenyl piperazine triptamin xanomeline ziprazidon zolmitriptan brl 15572 bromokriptin kabergolin gr 127935 lisuride oksimetazolin pergolide roxindole sb 216641 terguride bufotenine cyanopindolol fluspirilene galoperidol m chlorophenylpiperazine ketanserin metergoline methysergide ocaperidone pipamperone a yohimbine risperidon ritanserin SB 277 011 A sertindol spiperone yohimbine zotepine metitepine sumatriptan succinate donitriptan zimeldine rizatriptan zolmitriptan naratriptan hydrochloride Ontologiya genaMolekulyarna funkciya G protein coupled receptor activity signal transducer activity G protein coupled serotonin receptor activity neurotransmitter receptor activity serotonin bindingKlitinna komponenta integral component of membrane klitinna membrana integral component of plasma membrane membrana dendrit nejrobiologiya Biologichnij proces intestine smooth muscle contraction regulation of locomotion smooth muscle contraction G protein coupled receptor signaling pathway coupled to cyclic nucleotide second messenger regulation of behavior adenylate cyclase inhibiting G protein coupled receptor signaling pathway response to toxic substance vazokonstrikciya GO 0072468 signalna transdukciya chemical synaptic transmission G protein coupled serotonin receptor signaling pathway G protein coupled receptor signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3352 15552Ensembl ENSG00000179546 ENSMUSG00000070687UniProt P28221 Q61224RefSeq mRNK NM 000864NM 001285482 NM 001285483 NM 001285484 NM 008309RefSeq bilok NP 000855NP 001272411 NP 001272412 NP 001272413 NP 032335Lokus UCSC Hr 1 23 19 23 22 MbHr 4 136 15 136 17 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITL ATVLSNAFVLTTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTI THTWNFGQILCDIWLSSDITCCTASILHLCVIALDRYWAITDALEYSKRR TAGHAATMIAIVWAISICISIPPLFWRQAKAQEEMSDCLVNTSQISYTIY STCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAG SSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSL INPIIYTVFNEEFRQAFQKIVPFRKAS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv g bilokspryazhenih receptoriv Zadiyanij u takomu biologichnomu procesi yak polimorfizm Lokalizovanij u klitinnij membrani membrani LiteraturaWeinshank R L Zgombick J M Macchi M J Branchek T A Hartig P R 1992 Human serotonin 1D receptor is encoded by a subfamily of two distinct genes 5 HT1D alpha and 5 HT1D beta Proc Natl Acad Sci U S A 89 3630 3634 PMID 1565658 DOI 10 1073 pnas 89 8 3630 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Gonzalez Heydrich J Peroutka S J 1991 Postsynaptic localization of 5 HT1D receptor binding sites in human caudate Exp Neurol 113 28 30 PMID 1828434 DOI 10 1016 0014 4886 91 90142 Y Xie Z Lee S P O Dowd B F George S R 1999 Serotonin 5 HT1B and 5 HT1D receptors form homodimers when expressed alone and heterodimers when co expressed FEBS Lett 456 63 67 PMID 10452531 DOI 10 1016 S0014 5793 99 00918 7 Nichols D E Nichols C D 2008 Serotonin receptors Chem Rev 108 1614 1641 PMID 18476671 DOI 10 1021 cr078224o Hamblin M W Metcalf M A 1991 Primary structure and functional characterization of a human 5 HT1D type serotonin receptor Mol Pharmacol 40 143 148 PMID 1652050PrimitkiSpoluki yaki fizichno vzayemodiyut z 5 hydroxytryptamine receptor 1D pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 5289 angl Procitovano 25 serpnya 2017 angl Arhiv originalu za 16 serpnya 2017 Procitovano 25 serpnya 2017 Div takozhHromosoma 1 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ