H1F0 (англ. H1 histone family member 0) – білок, який кодується однойменним геном, розташованим у людей на довгому плечі 22-ї хромосоми. Довжина поліпептидного ланцюга білка становить 194 амінокислот, а молекулярна маса — 20 863.
H1F0 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Ідентифікатори | |||||||||||||||||
Символи | H1-0, H1FV, H1 histone family member 0, H1.0, H1.0 linker histone, H1F0 | ||||||||||||||||
Зовнішні ІД | OMIM: 142708 MGI: 95893 HomoloGene: 136788 GeneCards: H1-0 | ||||||||||||||||
| |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 22: 37.81 – 37.81 Mb | Хр. 15: 78.91 – 78.91 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
Представник родини білків гістонів H1.
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MTENSTSAPA | AKPKRAKASK | KSTDHPKYSD | MIVAAIQAEK | NRAGSSRQSI | ||||
QKYIKSHYKV | GENADSQIKL | SIKRLVTTGV | LKQTKGVGAS | GSFRLAKSDE | ||||
PKKSVAFKKT | KKEIKKVATP | KKASKPKKAA | SKAPTKKPKA | TPVKKAKKKL | ||||
AATPKKAKKP | KTVKAKPVKA | SKPKKAKPVK | PKAKSSAKRA | GKKK |
Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі, хромосомах.
Література
- Doenecke D., Tonjes R. (1986). Differential distribution of lysine and arginine residues in the closely related histones H1 and H5. Analysis of a human H1 gene. J. Mol. Biol. 187: 461—464. PMID 3084796 DOI:10.1016/0022-2836(86)90446-8
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Zougman A., Ziolkowski P., Mann M., Wisniewski J.R. (2008). Evidence for insertional RNA editing in humans. Curr. Biol. 18: 1760—1765. PMID 18993075 DOI:10.1016/j.cub.2008.09.059
- Lindner H., Sarg B., Hoertnagl B., Helliger W. (1998). The microheterogeneity of the mammalian H1(0) histone. Evidence for an age-dependent deamidation. J. Biol. Chem. 273: 13324—13330. PMID 9582379 DOI:10.1074/jbc.273.21.13324
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:4714 (англ.) . Архів оригіналу за 17 жовтня 2015. Процитовано 21 вересня 2017. [Архівовано 2015-10-17 у Wayback Machine.]
- UniProt, P07305 (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 21 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
H1F0 angl H1 histone family member 0 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na dovgomu plechi 22 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 194 aminokislot a molekulyarna masa 20 863 4 H1F0IdentifikatoriSimvoliH1 0 H1FV H1 histone family member 0 H1 0 H1 0 linker histone H1F0Zovnishni ID OMIM 142708 MGI 95893 HomoloGene 136788 GeneCards H1 0Ontologiya genaMolekulyarna funkciya DNA binding chromatin DNA binding GO 0001948 GO 0016582 protein binding RNA binding minor groove of adenine thymine rich DNA binding double stranded DNA binding nucleosomal DNA bindingKlitinna komponenta actin cytoskeleton hromosoma Nukleosoma kompleks Goldzhi klitinne yadro nukleoplazma yaderni tilcya transcription repressor complexBiologichnij proces nucleosome assembly apoptotic DNA fragmentation GO 1901227 negative regulation of transcription by RNA polymerase II GO 0009373 regulation of transcription DNA templated chromosome condensation negative regulation of DNA recombination positive regulation of transcription regulatory region DNA bindingDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez3005 14958Ensembl ENSG00000189060 ENSMUSG00000096210UniProt P07305 P10922RefSeq mRNK NM 005318NM 008197RefSeq bilok NP 005309NP 032223Lokus UCSC Hr 22 37 81 37 81 MbHr 15 78 91 78 91 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Predstavnik rodini bilkiv gistoniv H1 Poslidovnist aminokislot1020304050 MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSI QKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDE PKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKL AATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK A Alanin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak acetilyuvannya alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u yadri hromosomah Literaturared Doenecke D Tonjes R 1986 Differential distribution of lysine and arginine residues in the closely related histones H1 and H5 Analysis of a human H1 gene J Mol Biol 187 461 464 PMID 3084796 DOI 10 1016 0022 2836 86 90446 8 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Zougman A Ziolkowski P Mann M Wisniewski J R 2008 Evidence for insertional RNA editing in humans Curr Biol 18 1760 1765 PMID 18993075 DOI 10 1016 j cub 2008 09 059 Lindner H Sarg B Hoertnagl B Helliger W 1998 The microheterogeneity of the mammalian H1 0 histone Evidence for an age dependent deamidation J Biol Chem 273 13324 13330 PMID 9582379 DOI 10 1074 jbc 273 21 13324Primitkired Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 4714 angl Arhiv originalu za 17 zhovtnya 2015 Procitovano 21 veresnya 2017 Arhivovano 2015 10 17 u Wayback Machine UniProt P07305 angl Arhiv originalu za 8 serpnya 2017 Procitovano 21 veresnya 2017 Div takozhred Hromosoma 22 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title H1F0 amp oldid 44001191