Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

GFAP англ Glial fibrillary acidic protein білок який кодується однойменним геном розташованим у людей на короткому плечі

GFAP

GFAP

GFAP (англ. Glial fibrillary acidic protein) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми. Довжина поліпептидного ланцюга білка становить 432 амінокислот, а молекулярна маса — 49 880.

GFAP
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GFAP, ALXDRD, glial fibrillary acidic protein
Зовнішні ІД OMIM: 137780 MGI: 95697 HomoloGene: 1554 GeneCards: GFAP
Пов'язані генетичні захворювання
хвороба Вільяма Александера
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
2670
14580
Ensembl
ENSG00000131095
ENSMUSG00000020932
UniProt
P14136
P03995
RefSeq (мРНК)
NM_002055
NM_001131019
NM_001242376
NM_001363846
NM_001131020
NM_010277
RefSeq (білок)
NP_001124491
NP_001229305
NP_002046
NP_001350775
NP_001124492
NP_034407
Локус (UCSC) Хр. 17: 44.9 – 44.92 Mb Хр. 11: 102.78 – 102.79 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRV
DFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAE
LNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLAT
VRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFL
RKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNM
HEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR
GTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQ
DLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVS
EGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у цитоплазмі, проміжних філаментах.

Література

  • Reeves S.A., Helman L.J., Allison A., Israel M.A. (1989). Molecular cloning and primary structure of human glial fibrillary acidic protein. Proc. Natl. Acad. Sci. U.S.A. 86: 5178—5182. PMID 2740350 DOI:10.1073/pnas.86.13.5178
  • Isaacs A., Baker M., Wavrant-De Vrieze F., Hutton M. (1998). Determination of the gene structure of human GFAP and absence of coding region mutations associated with frontotemporal dementia with parkinsonism linked to chromosome 17. Genomics. 51: 152—154. PMID 9693047 DOI:10.1006/geno.1998.5360
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Nakatani Y., Brenner M., Freese E. (1990). An RNA polymerase II promoter containing sequences upstream and downstream from the RNA startpoint that direct initiation of transcription from the same site. Proc. Natl. Acad. Sci. U.S.A. 87: 4289—4293. PMID 2349237 DOI:10.1073/pnas.87.11.4289
  • Duguid J.R., Bohmont C.W., Liu N.G., Tourtellotte W.W. (1989). Changes in brain gene expression shared by scrapie and Alzheimer disease. Proc. Natl. Acad. Sci. U.S.A. 86: 7260—7264. PMID 2780570 DOI:10.1073/pnas.86.18.7260
  • Singh R., Nielsen A.L., Johansen M.G., Jorgensen A.L. (2003). Genetic polymorphism and sequence evolution of an alternatively spliced exon of the glial fibrillary acidic protein gene, GFAP. Genomics. 82: 185—193. PMID 12837269 DOI:10.1016/S0888-7543(03)00106-X

Примітки

  1. Захворювання, генетично пов'язані з GFAP переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:4235 (англ.) . Процитовано 12 вересня 2017.
  5. (англ.) . Архів оригіналу за 25 вересня 2017. Процитовано 12 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

GFAP angl Glial fibrillary acidic protein bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 17 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 432 aminokislot a molekulyarna masa 49 880 GFAPNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB6A9PIdentifikatoriSimvoliGFAP ALXDRD glial fibrillary acidic proteinZovnishni ID OMIM 137780 MGI 95697 HomoloGene 1554 GeneCards GFAPPov yazani genetichni zahvoryuvannyahvoroba Vilyama Aleksandera Ontologiya genaMolekulyarna funkciya structural molecule activity GO 0001948 GO 0016582 protein binding identical protein binding integrin binding structural constituent of cytoskeleton kinase bindingKlitinna komponenta citoplazma gialoplazma lizosoma Promizhni filamenti vnutrishnoklitinnij membrana cell projection myelin sheath cell body glial cell projection astrocyte projection astrocyte end foot cytoplasmic side of lysosomal membrane citoskeletBiologichnij proces GO 0106159 regulation of protein containing complex assembly response to wounding positive regulation of Schwann cell proliferation negative regulation of neuron projection development astrocyte development extracellular matrix organization neuron projection regeneration intermediate filament based process regulation of neurotransmitter uptake Bergmann glial cell differentiation positive regulation of glial cell proliferation dovgotrivala potenciaciya regulation of chaperone mediated autophagy intermediate filament organizationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2670 14580Ensembl ENSG00000131095 ENSMUSG00000020932UniProt P14136 P03995RefSeq mRNK NM 002055 NM 001131019 NM 001242376 NM 001363846NM 001131020 NM 010277RefSeq bilok NP 001124491 NP 001229305 NP 002046 NP 001350775NP 001124492 NP 034407Lokus UCSC Hr 17 44 9 44 92 MbHr 11 102 78 102 79 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRV DFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAE LNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLAT VRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFL RKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNM HEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR GTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQ DLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVS EGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Lokalizovanij u citoplazmi promizhnih filamentah LiteraturaReeves S A Helman L J Allison A Israel M A 1989 Molecular cloning and primary structure of human glial fibrillary acidic protein Proc Natl Acad Sci U S A 86 5178 5182 PMID 2740350 DOI 10 1073 pnas 86 13 5178 Isaacs A Baker M Wavrant De Vrieze F Hutton M 1998 Determination of the gene structure of human GFAP and absence of coding region mutations associated with frontotemporal dementia with parkinsonism linked to chromosome 17 Genomics 51 152 154 PMID 9693047 DOI 10 1006 geno 1998 5360 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Nakatani Y Brenner M Freese E 1990 An RNA polymerase II promoter containing sequences upstream and downstream from the RNA startpoint that direct initiation of transcription from the same site Proc Natl Acad Sci U S A 87 4289 4293 PMID 2349237 DOI 10 1073 pnas 87 11 4289 Duguid J R Bohmont C W Liu N G Tourtellotte W W 1989 Changes in brain gene expression shared by scrapie and Alzheimer disease Proc Natl Acad Sci U S A 86 7260 7264 PMID 2780570 DOI 10 1073 pnas 86 18 7260 Singh R Nielsen A L Johansen M G Jorgensen A L 2003 Genetic polymorphism and sequence evolution of an alternatively spliced exon of the glial fibrillary acidic protein gene GFAP Genomics 82 185 193 PMID 12837269 DOI 10 1016 S0888 7543 03 00106 XPrimitkiZahvoryuvannya genetichno pov yazani z GFAP pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 4235 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 25 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 17 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ