GCH1 (англ. GTP cyclohydrolase 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми. Довжина поліпептидного ланцюга білка становить 250 амінокислот, а молекулярна маса — 27 903.
GCH1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() | |||||||||||||||||
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | GCH1, DYT14, DYT5, DYT5a, GCH, GTP-CH-1, GTPCH1, HPABH4B, GTP cyclohydrolase 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 600225 MGI: 95675 HomoloGene: 132 GeneCards: GCH1 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
ожиріння, ревматоїдний артрит, GTP cyclohydrolase I deficiency | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
![]() | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 14: 54.84 – 54.9 Mb | Хр. 14: 47.39 – 47.43 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MEKGPVRAPA | EKPRGARCSN | GFPERDPPRP | GPSRPAEKPP | RPEAKSAQPA | ||||
DGWKGERPRS | EEDNELNLPN | LAAAYSSILS | SLGENPQRQG | LLKTPWRAAS | ||||
AMQFFTKGYQ | ETISDVLNDA | IFDEDHDEMV | IVKDIDMFSM | CEHHLVPFVG | ||||
KVHIGYLPNK | QVLGLSKLAR | IVEIYSRRLQ | VQERLTKQIA | VAITEALRPA | ||||
GVGVVVEATH | MCMVMRGVQK | MNSKTVTSTM | LGVFREDPKT | REEFLTLIRS | ||||
Кодований геном білок за функціями належить до гідролаз, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з нуклеотидами, іонами металів, іоном цинку, ГТФ. Локалізований у цитоплазмі, ядрі.
Література
- Togari A., Ichinose H., Matsumoto S., Fujita K., Nagatsu T. (1992). Multiple mRNA forms of human GTP cyclohydrolase I. Biochem. Biophys. Res. Commun. 187: 359—365. PMID 1520321 DOI:10.1016/S0006-291X(05)81501-3
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Blau N., Niederwieser A. (1986). The application of 8-aminoguanosine triphosphate, a new inhibitor of GTP cyclohydrolase I, to the purification of the enzyme from human liver. Biochim. Biophys. Acta. 880: 26—31. PMID 3753653 DOI:10.1016/0304-4165(86)90115-7
- Shen R.-S., Alam A., Zhang Y.X. (1989). Human liver GTP cyclohydrolase I: purification and some properties. Biochimie. 71: 343—349. PMID 2500984 DOI:10.1016/0300-9084(89)90006-0
- Schoedon G., Redweik U., Curtius H.-C. (1989). Purification of GTP cyclohydrolase I from human liver and production of specific monoclonal antibodies. Eur. J. Biochem. 178: 627—634. PMID 2463916 DOI:10.1111/j.1432-1033.1989.tb14491.x
- Thoeny B., Blau N. (1997). Mutations in the GTP cyclohydrolase I and 6-pyruvoyl-tetrahydropterin synthase genes. Hum. Mutat. 10: 11—20. PMID 9222755 DOI:10.1002/(SICI)1098-1004(1997)10:1<11::AID-HUMU2>3.0.CO;2-P
Примітки
- Захворювання, генетично пов'язані з GCH1 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:4193 (англ.) . Процитовано 11 вересня 2017.
- (англ.) . Архів оригіналу за 1 вересня 2017. Процитовано 11 вересня 2017.
Див. також
![]() | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
GCH1 angl GTP cyclohydrolase 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 14 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 250 aminokislot a molekulyarna masa 27 903 GCH1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1FB1IdentifikatoriSimvoliGCH1 DYT14 DYT5 DYT5a GCH GTP CH 1 GTPCH1 HPABH4B GTP cyclohydrolase 1Zovnishni ID OMIM 600225 MGI 95675 HomoloGene 132 GeneCards GCH1Pov yazani genetichni zahvoryuvannyaozhirinnya revmatoyidnij artrit GTP cyclohydrolase I deficiency Ontologiya genaMolekulyarna funkciya nucleotide binding calcium ion binding protein homodimerization activity zinc ion binding GTP binding zv yazuvannya z ionom metalu GO 0001948 GO 0016582 protein binding katalitichna aktivnist hydrolase activity GTP cyclohydrolase I activity mitogen activated protein kinase binding GO 0006184 GTPase activity GTP dependent protein binding translation initiation factor bindingKlitinna komponenta citoplazma gialoplazma yaderna membrana nukleoplazma GO 0016023 cytoplasmic vesicle klitinne yadro neuron projection terminus GO 0009327 protein containing complexBiologichnij proces nitric oxide biosynthetic process response to interferon gamma neuromuscular process controlling posture protein heterooligomerization negative regulation of blood pressure dopamine biosynthetic process regulation of lung blood pressure vazodilataciya pteridine containing compound biosynthetic process 7 8 dihydroneopterin 3 triphosphate biosynthetic process dihydrobiopterin metabolic process regulation of blood pressure response to tumor necrosis factor tetrahydrofolate biosynthetic process response to lipopolysaccharide positive regulation of nitric oxide synthase activity response to pain tetrahydrobiopterin biosynthetic process obmin rechovin protein homooligomerization regulation of removal of superoxide radicals positive regulation of heart rate GO 0034622 protein containing complex assemblyDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2643 14528Ensembl ENSG00000131979 ENSMUSG00000037580UniProt P30793 Q05915RefSeq mRNK NM 000161 NM 001024024 NM 001024070 NM 001024071NM 008102RefSeq bilok NP 000152 NP 001019195 NP 001019241 NP 001019242NP 032128Lokus UCSC Hr 14 54 84 54 9 MbHr 14 47 39 47 43 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPA DGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAAS AMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVG KVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPA GVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do gidrolaz fosfoproteyiniv Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z nukleotidami ionami metaliv ionom cinku GTF Lokalizovanij u citoplazmi yadri LiteraturaTogari A Ichinose H Matsumoto S Fujita K Nagatsu T 1992 Multiple mRNA forms of human GTP cyclohydrolase I Biochem Biophys Res Commun 187 359 365 PMID 1520321 DOI 10 1016 S0006 291X 05 81501 3 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Blau N Niederwieser A 1986 The application of 8 aminoguanosine triphosphate a new inhibitor of GTP cyclohydrolase I to the purification of the enzyme from human liver Biochim Biophys Acta 880 26 31 PMID 3753653 DOI 10 1016 0304 4165 86 90115 7 Shen R S Alam A Zhang Y X 1989 Human liver GTP cyclohydrolase I purification and some properties Biochimie 71 343 349 PMID 2500984 DOI 10 1016 0300 9084 89 90006 0 Schoedon G Redweik U Curtius H C 1989 Purification of GTP cyclohydrolase I from human liver and production of specific monoclonal antibodies Eur J Biochem 178 627 634 PMID 2463916 DOI 10 1111 j 1432 1033 1989 tb14491 x Thoeny B Blau N 1997 Mutations in the GTP cyclohydrolase I and 6 pyruvoyl tetrahydropterin synthase genes Hum Mutat 10 11 20 PMID 9222755 DOI 10 1002 SICI 1098 1004 1997 10 1 lt 11 AID HUMU2 gt 3 0 CO 2 PPrimitkiZahvoryuvannya genetichno pov yazani z GCH1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 4193 angl Procitovano 11 veresnya 2017 angl Arhiv originalu za 1 veresnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 14 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi