FOXO4 (англ. Forkhead box O4) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі. Довжина поліпептидного ланцюга білка становить 505 амінокислот, а молекулярна маса — 53 684.
FOXO4 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | FOXO4, AFX, AFX1, MLLT7, forkhead box O4 | ||||||||||||||||
Зовнішні ІД | OMIM: 300033 MGI: 1891915 HomoloGene: 4342 GeneCards: FOXO4 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. X: 71.1 – 71.1 Mb | Хр. X: 100.3 – 100.3 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MDPGNENSAT | EAAAIIDLDP | DFEPQSRPRS | CTWPLPRPEI | ANQPSEPPEV | ||||
EPDLGEKVHT | EGRSEPILLP | SRLPEPAGGP | QPGILGAVTG | PRKGGSRRNA | ||||
WGNQSYAELI | SQAIESAPEK | RLTLAQIYEW | MVRTVPYFKD | KGDSNSSAGW | ||||
KNSIRHNLSL | HSKFIKVHNE | ATGKSSWWML | NPEGGKSGKA | PRRRAASMDS | ||||
SSKLLRGRSK | APKKKPSVLP | APPEGATPTS | PVGHFAKWSG | SPCSRNREEA | ||||
DMWTTFRPRS | SSNASSVSTR | LSPLRPESEV | LAEEIPASVS | SYAGGVPPTL | ||||
NEGLELLDGL | NLTSSHSLLS | RSGLSGFSLQ | HPGVTGPLHT | YSSSLFSPAE | ||||
GPLSAGEGCF | SSSQALEALL | TSDTPPPPAD | VLMTQVDPIL | SQAPTLLLLG | ||||
GLPSSSKLAT | GVGLCPKPLE | APGPSSLVPT | LSMIAPPPVM | ASAPIPKALG | ||||
TPVLTPPTEA | ASQDRMPQDL | DLDMYMENLE | CDMDNIISDL | MDEGEGLDFN | ||||
FEPDP |
Кодований геном білок за функціями належить до активаторів, , фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, клітинний цикл, диференціація клітин, міогенез, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.
Література
- Peters U., Haberhausen G., Kostrzewa M., Nolte D., Mueller U. (1997). AFX1 and p54nrb: fine mapping, genomic structure, and exclusion as candidate genes of X-linked dystonia parkinsonism. Hum. Genet. 100: 569—572. PMID 9341872 DOI:10.1007/s004390050553
- Yang Z., Whelan J., Babb R., Bowen B.R. (2002). An mRNA splice variant of the AFX gene with altered transcriptional activity. J. Biol. Chem. 277: 8068—8075. PMID 11779849 DOI:10.1074/jbc.M106091200
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Parry P., Wei Y., Evans G. (1994). Cloning and characterization of the t(X;11) breakpoint from a leukemic cell line identify a new member of the forkhead gene family. Genes Chromosomes Cancer. 11: 79—84. PMID 7529552 DOI:10.1002/gcc.2870110203
- Medema R.H., Kops G.J.P.L., Bos J.L., Burgering B.M.T. (2000). AFX-like forkhead transcription factors mediate cell-cycle regulation by Ras and PKB through p27kip1. Nature. 404: 782—787. PMID 10783894 DOI:10.1038/35008115
- Tang T.T.-L., Lasky L.A. (2003). The forkhead transcription factor FOXO4 induces the down-regulation of hypoxia-inducible factor 1 alpha by a von Hippel-Lindau protein-independent mechanism. J. Biol. Chem. 278: 30125—30135. PMID 12761217 DOI:10.1074/jbc.M302042200
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 12 березня 2016. Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
FOXO4 angl Forkhead box O4 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na X hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 505 aminokislot a molekulyarna masa 53 684 FOXO4Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1E17 3L2CIdentifikatoriSimvoliFOXO4 AFX AFX1 MLLT7 forkhead box O4Zovnishni ID OMIM 300033 MGI 1891915 HomoloGene 4342 GeneCards FOXO4Ontologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein binding enzyme binding transcription factor binding beta catenin binding identical protein binding DNA binding GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity promoter specific chromatin binding GO 0001077 GO 0001212 GO 0001213 GO 0001211 GO 0001205 DNA binding transcription activator activity RNA polymerase II specific sequence specific DNA binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specificKlitinna komponenta citoplazma gialoplazma klitinne yadro nukleoplazma nuclear speckBiologichnij proces GO 0060469 GO 0009371 positive regulation of transcription DNA templated negative regulation of smooth muscle cell differentiation negative regulation of G0 to G1 transition GO 1901047 insulin receptor signaling pathway negative regulation of angiogenesis multicellular organism development diferenciaciya klitin transcription DNA templated muscle organ development stem cell differentiation transcription by RNA polymerase II GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II mitotic G2 DNA damage checkpoint signaling klitinnij cikl GO 0009373 regulation of transcription DNA templated negative regulation of cell population proliferation response to water immersion restraint stress response to nutrient levels GO 0010260 starinnya lyudini positive regulation of smooth muscle cell migration protein deubiquitination GO 1901227 negative regulation of transcription by RNA polymerase II glucose homeostasisDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez4303 54601Ensembl ENSG00000184481 ENSMUSG00000042903UniProt P98177 Q9WVH3RefSeq mRNK NM 001170931 NM 005938NM 018789RefSeq bilok NP 001164402 NP 005929NP 061259Lokus UCSC Hr X 71 1 71 1 MbHr X 100 3 100 3 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MDPGNENSATEAAAIIDLDPDFEPQSRPRSCTWPLPRPEIANQPSEPPEV EPDLGEKVHTEGRSEPILLPSRLPEPAGGPQPGILGAVTGPRKGGSRRNA WGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGW KNSIRHNLSLHSKFIKVHNEATGKSSWWMLNPEGGKSGKAPRRRAASMDS SSKLLRGRSKAPKKKPSVLPAPPEGATPTSPVGHFAKWSGSPCSRNREEA DMWTTFRPRSSSNASSVSTRLSPLRPESEVLAEEIPASVSSYAGGVPPTL NEGLELLDGLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAE GPLSAGEGCFSSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLG GLPSSSKLATGVGLCPKPLEAPGPSSLVPTLSMIAPPPVMASAPIPKALG TPVLTPPTEAASQDRMPQDLDLDMYMENLECDMDNIISDLMDEGEGLDFN FEPDP A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do aktivatoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi klitinnij cikl diferenciaciya klitin miogenez acetilyuvannya alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u citoplazmi yadri LiteraturaPeters U Haberhausen G Kostrzewa M Nolte D Mueller U 1997 AFX1 and p54nrb fine mapping genomic structure and exclusion as candidate genes of X linked dystonia parkinsonism Hum Genet 100 569 572 PMID 9341872 DOI 10 1007 s004390050553 Yang Z Whelan J Babb R Bowen B R 2002 An mRNA splice variant of the AFX gene with altered transcriptional activity J Biol Chem 277 8068 8075 PMID 11779849 DOI 10 1074 jbc M106091200 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Parry P Wei Y Evans G 1994 Cloning and characterization of the t X 11 breakpoint from a leukemic cell line identify a new member of the forkhead gene family Genes Chromosomes Cancer 11 79 84 PMID 7529552 DOI 10 1002 gcc 2870110203 Medema R H Kops G J P L Bos J L Burgering B M T 2000 AFX like forkhead transcription factors mediate cell cycle regulation by Ras and PKB through p27kip1 Nature 404 782 787 PMID 10783894 DOI 10 1038 35008115 Tang T T L Lasky L A 2003 The forkhead transcription factor FOXO4 induces the down regulation of hypoxia inducible factor 1 alpha by a von Hippel Lindau protein independent mechanism J Biol Chem 278 30125 30135 PMID 12761217 DOI 10 1074 jbc M302042200PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 12 bereznya 2016 Procitovano 12 veresnya 2017 angl Arhiv originalu za 8 serpnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma X Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi