Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

FGF10 англ Fibroblast growth factor 10 білок який кодується однойменним геном розташованим у людей на короткому плечі 5

FGF10

FGF10

FGF10 (англ. Fibroblast growth factor 10) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. Довжина поліпептидного ланцюга білка становить 208 амінокислот, а молекулярна маса — 23 436.

FGF10
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи FGF10, fibroblast growth factor 10
Зовнішні ІД OMIM: 602115 MGI: 1099809 HomoloGene: 3284 GeneCards: FGF10
Пов'язані генетичні захворювання
рак простати, LADD syndrome
Ортологи
Види Людина Миша
Entrez
2255
14165
Ensembl
ENSG00000070193
ENSMUSG00000021732
UniProt
O15520
O35565
RefSeq (мРНК)
NM_004465
NM_008002
RefSeq (білок)
NP_004456
NP_032028
Локус (UCSC) Хр. 5: 44.3 – 44.39 Mb Хр. 13: 118.81 – 118.93 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MWKWILTHCASAFPHLPGCCCCCFLLLFLVSSVPVTCQALGQDMVSPEAT
NSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSG
TKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDC
KLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAH
FLPMVVHS

Кодований геном білок за функцією належить до факторів росту. Секретований назовні.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Turner N., Grose R. (2010). Fibroblast growth factor signalling: from development to cancer. Nat. Rev. Cancer. 10: 116—129. PMID 20094046 DOI:10.1038/nrc2780
  • Milunsky J.M., Zhao G., Maher T.A., Colby R., Everman D.B. (2006). LADD syndrome is caused by FGF10 mutations. Clin. Genet. 69: 349—354. PMID 16630169 DOI:10.1111/j.1399-0004.2006.00597.x

Примітки

  1. Захворювання, генетично пов'язані з FGF10 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:3666 (англ.) . Процитовано 31 серпня 2017.
  5. (англ.) . Архів оригіналу за 6 жовтня 2017. Процитовано 31 серпня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.
На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка розставте посилання відповідно до .

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

FGF10 angl Fibroblast growth factor 10 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 5 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 208 aminokislot a molekulyarna masa 23 436 FGF10Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1NUNIdentifikatoriSimvoliFGF10 fibroblast growth factor 10Zovnishni ID OMIM 602115 MGI 1099809 HomoloGene 3284 GeneCards FGF10Pov yazani genetichni zahvoryuvannyarak prostati LADD syndrome Ontologiya genaMolekulyarna funkciya heparin binding type 2 fibroblast growth factor receptor binding growth factor activity GO 0001948 GO 0016582 protein binding fibroblast growth factor receptor binding chemoattractant activity protein tyrosine kinase activity 1 phosphatidylinositol 3 kinase activity phosphatidylinositol 4 5 bisphosphate 3 kinase activityKlitinna komponenta extracellular region klitinne yadro cell surface GO 0005578 Pozaklitinna matricya klitinna membrana mizhklitinnij prostir collagen containing extracellular matrixBiologichnij proces bud outgrowth involved in lung branching limb bud formation organ growth semicircular canal morphogenesis embryonic pattern specification bud elongation involved in lung branching positive regulation of canonical Wnt signaling pathway muscle cell fate commitment slozovidilennya positive regulation of Ras protein signal transduction positive regulation of urothelial cell proliferation regulation of branching involved in salivary gland morphogenesis by mesenchymal epithelial signaling limb development radial glial cell differentiation female genitalia morphogenesis mesonephros development odontogenesis of dentin containing tooth prostatic bud formation blood vessel remodeling regulation of saliva secretion Angiogenez establishment of mitotic spindle orientation positive regulation of ERK1 and ERK2 cascade embryonic digestive tract morphogenesis animal organ morphogenesis hair follicle morphogenesis metanephros development lung saccule development lung epithelium development positive regulation of Notch signaling pathway negative regulation of cell population proliferation branch elongation involved in salivary gland morphogenesis branching involved in salivary gland morphogenesis positive regulation of white fat cell proliferation bronchiole morphogenesis limb morphogenesis blood vessel morphogenesis lung development thymus development positive regulation of fibroblast proliferation negative regulation of cell differentiation ERK1 and ERK2 cascade positive regulation of epithelial cell migration positive regulation of mitotic cell cycle spleen development smooth muscle cell differentiation GO 0060469 GO 0009371 positive regulation of transcription DNA templated positive regulation of Wnt signaling pathway Harderian gland development protein localization to cell surface respiratory system development epidermis development positive regulation of peptidyl tyrosine phosphorylation metanephros morphogenesis pancreas development mammary gland bud formation positive chemotaxis mesenchymal epithelial cell signaling involved in lung development positive regulation of hair follicle cell proliferation lacrimal gland development positive regulation of MAPK cascade diferenciaciya klitin positive regulation of keratinocyte proliferation positive regulation of ATP dependent activity positive regulation of epithelial cell proliferation involved in wound healing epithelial cell differentiation organ induction positive regulation of epithelial cell proliferation epidermis morphogenesis Zagoyennya ran epithelial cell proliferation regulation of activin receptor signaling pathway positive regulation of DNA replication hemotaksis embryonic genitalia morphogenesis salivary gland development positive regulation of keratinocyte migration response to lipopolysaccharide thyroid gland development keratinocyte proliferation semicircular canal fusion mammary gland specification epithelial cell migration white fat cell differentiation regulyaciya ekspresiyi geniv lung alveolus development branching morphogenesis of an epithelial tube embryonic digestive tract development lung proximal distal axis specification fibroblast growth factor receptor signaling pathway involved in mammary gland specification actin cytoskeleton reorganization positive regulation of vascular endothelial growth factor receptor signaling pathway pituitary gland development response to estradiol secretion by lung epithelial cell involved in lung growth mesenchymal cell differentiation involved in lung development lung morphogenesis GO 1904578 response to organic cyclic compound somatic stem cell population maintenance tissue regeneration otic vesicle formation epithelial cell proliferation involved in salivary gland morphogenesis cell cell signaling male genitalia morphogenesis GO 1900404 positive regulation of DNA repair salivary gland morphogenesis MAPK cascade embryonic camera type eye development induction of positive chemotaxis urothelial cell proliferation animal organ formation fibroblast growth factor receptor signaling pathway regulation of smoothened signaling pathway determination of left right symmetry inner ear morphogenesis positive regulation of cell population proliferation submandibular salivary gland formation type II pneumocyte differentiation negative regulation of extrinsic apoptotic signaling pathway in absence of ligand digestive tract development regulation of epithelial cell proliferation epithelial tube branching involved in lung morphogenesis positive regulation of lymphocyte proliferation GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II phosphatidylinositol phosphate biosynthetic process phosphatidylinositol 3 phosphate biosynthetic process peptidyl tyrosine phosphorylation regulation of signaling receptor activity positive regulation of protein kinase B signaling positive regulation of G1 S transition of mitotic cell cycleDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez2255 14165Ensembl ENSG00000070193 ENSMUSG00000021732UniProt O15520 O35565RefSeq mRNK NM 004465NM 008002RefSeq bilok NP 004456NP 032028Lokus UCSC Hr 5 44 3 44 39 MbHr 13 118 81 118 93 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MWKWILTHCASAFPHLPGCCCCCFLLLFLVSSVPVTCQALGQDMVSPEAT NSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSG TKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDC KLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAH FLPMVVHS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do faktoriv rostu Sekretovanij nazovni LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Turner N Grose R 2010 Fibroblast growth factor signalling from development to cancer Nat Rev Cancer 10 116 129 PMID 20094046 DOI 10 1038 nrc2780 Milunsky J M Zhao G Maher T A Colby R Everman D B 2006 LADD syndrome is caused by FGF10 mutations Clin Genet 69 349 354 PMID 16630169 DOI 10 1111 j 1399 0004 2006 00597 xPrimitkiZahvoryuvannya genetichno pov yazani z FGF10 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 3666 angl Procitovano 31 serpnya 2017 angl Arhiv originalu za 6 zhovtnya 2017 Procitovano 31 serpnya 2017 Div takozhHromosoma 5 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Na cyu stattyu ne posilayutsya inshi statti Vikipediyi Bud laska rozstavte posilannya vidpovidno do prijnyatih rekomendacij

Дата публікації:
Топ