Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

CTLA4 англ Cytotoxic T lymphocyte associated protein 4 білок який кодується однойменним геном розташованим у людей на ко

CTLA4

CTLA4

CTLA4 (англ. Cytotoxic T-lymphocyte associated protein 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. Довжина поліпептидного ланцюга білка становить 223 амінокислот, а молекулярна маса — 24 656.

CTLA4
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CTLA4, ALPS5, CD, CD152, CELIAC3, CTLA-4, GRD4, GSE, IDDM12, cytotoxic T-lymphocyte associated protein 4
Зовнішні ІД OMIM: 123890 MGI: 88556 HomoloGene: 3820 GeneCards: CTLA4
Пов'язані генетичні захворювання
ревматоїдний артрит, гіпотиреоз, цукровий діабет тип 1, type 1 diabetes mellitus 12, autoimmune lymphoproliferative syndrome due to CTLA4 haploinsuffiency
Реагує на сполуку
іпілімумаб
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
1493
12477
Ensembl
ENSG00000163599
ENSMUSG00000026011
UniProt
P16410
P09793
RefSeq (мРНК)
NM_001037631
NM_005214
NM_001281976
NM_009843
RefSeq (білок)
NP_001032720
NP_005205
NP_001268905
NP_033973
Локус (UCSC) Хр. 2: 203.85 – 203.87 Mb Хр. 1: 60.93 – 60.95 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASS
RGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDD
SICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIY
VIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGV
YVKMPPTEPECEKQFQPYFIPIN

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як адаптивний імунітет, імунітет, поліморфізм, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Dariavach P., Mattei M.-G., Golstein P., Lefranc M.-P. (1988). Human Ig superfamily CTLA-4 gene: chromosomal localization and identity of protein sequence between murine and human CTLA-4 cytoplasmic domains. Eur. J. Immunol. 18: 1901—1905. PMID 3220103 DOI:10.1002/eji.1830181206
  • Schneider H., Schwartzberg P.L., Rudd C.E. (1998). Resting lymphocyte kinase (Rlk/Txk) phosphorylates the YVKM motif and regulates PI 3-kinase binding to T-cell antigen CTLA-4. Biochem. Biophys. Res. Commun. 252: 14—19. PMID 9813138 DOI:10.1006/bbrc.1998.9559
  • Chikuma S., Murakami M., Tanaka K., Uede T. (2000). Janus kinase 2 is associated with a box 1-like motif and phosphorylates a critical tyrosine residue in the cytoplasmic region of cytotoxic T lymphocyte associated molecule-4. J. Cell. Biochem. 78: 241—250. PMID 10842319 DOI:10.1002/(SICI)1097-4644(20000801)78:2<241::AID-JCB7>3.0.CO;2-K
  • Darlington P.J., Kirchhof M.G., Criado G., Sondhi J., Madrenas J. (2005). Hierarchical regulation of CTLA-4 dimer-based lattice formation and its biological relevance for T cell inactivation. J. Immunol. 175: 996—1004. PMID 16002699 DOI:10.4049/jimmunol.175.2.996
  • Teft W.A., Kirchhof M.G., Madrenas J. (2006). A molecular perspective of CTLA-4 function. Annu. Rev. Immunol. 24: 65—97. PMID 16551244 DOI:10.1146/annurev.immunol.24.021605.090535

Примітки

  1. Захворювання, генетично пов'язані з CTLA4 переглянути/редагувати посилання на ВікіДаних.
  2. Сполуки, які фізично взаємодіють з CTLA4 переглянути/редагувати посилання на ВікіДаних.
  3. Human PubMed Reference:.
  4. Mouse PubMed Reference:.
  5. (англ.) . Архів оригіналу за 31 липня 2017. Процитовано 28 серпня 2017.
  6. (англ.) . Архів оригіналу за 25 серпня 2017. Процитовано 28 серпня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

CTLA4 angl Cytotoxic T lymphocyte associated protein 4 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 2 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 223 aminokislot a molekulyarna masa 24 656 CTLA4Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB3OSK 1AH1 1H6E 1I85 1I8L 2X44 3BX7IdentifikatoriSimvoliCTLA4 ALPS5 CD CD152 CELIAC3 CTLA 4 GRD4 GSE IDDM12 cytotoxic T lymphocyte associated protein 4Zovnishni ID OMIM 123890 MGI 88556 HomoloGene 3820 GeneCards CTLA4Pov yazani genetichni zahvoryuvannyarevmatoyidnij artrit gipotireoz cukrovij diabet tip 1 type 1 diabetes mellitus 12 autoimmune lymphoproliferative syndrome due to CTLA4 haploinsuffiency Reaguye na spolukuipilimumab Ontologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein bindingKlitinna komponenta perinuclear region of cytoplasm integral component of membrane clathrin coated endocytic vesicle klitinna membrana kompleks Goldzhi membrana external side of plasma membrane protein complex involved in cell adhesion integral component of plasma membraneBiologichnij proces B cell receptor signaling pathway T cell costimulation negative regulation of B cell proliferation adaptivna imunna vidpovid negative regulation of regulatory T cell differentiation GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid cellular response to DNA damage stimulus proces imunnoyi sistemi positive regulation of apoptotic process negative regulation of immune response negative regulation of T cell proliferation regulation of regulatory T cell differentiation regulation of T cell proliferation T cell receptor signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1493 12477Ensembl ENSG00000163599 ENSMUSG00000026011UniProt P16410 P09793RefSeq mRNK NM 001037631 NM 005214NM 001281976 NM 009843RefSeq bilok NP 001032720 NP 005205NP 001268905 NP 033973Lokus UCSC Hr 2 203 85 203 87 MbHr 1 60 93 60 95 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASS RGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDD SICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIY VIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGV YVKMPPTEPECEKQFQPYFIPIN A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak adaptivnij imunitet imunitet polimorfizm alternativnij splajsing Lokalizovanij u klitinnij membrani membrani LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Dariavach P Mattei M G Golstein P Lefranc M P 1988 Human Ig superfamily CTLA 4 gene chromosomal localization and identity of protein sequence between murine and human CTLA 4 cytoplasmic domains Eur J Immunol 18 1901 1905 PMID 3220103 DOI 10 1002 eji 1830181206 Schneider H Schwartzberg P L Rudd C E 1998 Resting lymphocyte kinase Rlk Txk phosphorylates the YVKM motif and regulates PI 3 kinase binding to T cell antigen CTLA 4 Biochem Biophys Res Commun 252 14 19 PMID 9813138 DOI 10 1006 bbrc 1998 9559 Chikuma S Murakami M Tanaka K Uede T 2000 Janus kinase 2 is associated with a box 1 like motif and phosphorylates a critical tyrosine residue in the cytoplasmic region of cytotoxic T lymphocyte associated molecule 4 J Cell Biochem 78 241 250 PMID 10842319 DOI 10 1002 SICI 1097 4644 20000801 78 2 lt 241 AID JCB7 gt 3 0 CO 2 K Darlington P J Kirchhof M G Criado G Sondhi J Madrenas J 2005 Hierarchical regulation of CTLA 4 dimer based lattice formation and its biological relevance for T cell inactivation J Immunol 175 996 1004 PMID 16002699 DOI 10 4049 jimmunol 175 2 996 Teft W A Kirchhof M G Madrenas J 2006 A molecular perspective of CTLA 4 function Annu Rev Immunol 24 65 97 PMID 16551244 DOI 10 1146 annurev immunol 24 021605 090535PrimitkiZahvoryuvannya genetichno pov yazani z CTLA4 pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z CTLA4 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 31 lipnya 2017 Procitovano 28 serpnya 2017 angl Arhiv originalu za 25 serpnya 2017 Procitovano 28 serpnya 2017 Div takozhHromosoma 2 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ