CNR2 (англ. Cannabinoid receptor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 360 амінокислот, а молекулярна маса — 39 681.
CNR2 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CNR2, CB-2, CB2, CX5, Cannabinoid receptor type 2, cannabinoid receptor 2 | ||||||||||||||||
Зовнішні ІД | OMIM: 605051 MGI: 104650 HomoloGene: 1389 GeneCards: CNR2 | ||||||||||||||||
Реагує на сполуку | |||||||||||||||||
AM-1241, HU-210, JWH-133, L-759,633, L-759,656, HU-243, win 55212-2, 2-Арахідоноїлгліцерин, Анандамід, тетрагідроканнабінол, 6-iodopravadoline, SR144528, TM-38837 | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 1: 23.87 – 23.91 Mb | Хр. 4: 135.62 – 135.65 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MEECWVTEIA | NGSKDGLDSN | PMKDYMILSG | PQKTAVAVLC | TLLGLLSALE | ||||
NVAVLYLILS | SHQLRRKPSY | LFIGSLAGAD | FLASVVFACS | FVNFHVFHGV | ||||
DSKAVFLLKI | GSVTMTFTAS | VGSLLLTAID | RYLCLRYPPS | YKALLTRGRA | ||||
LVTLGIMWVL | SALVSYLPLM | GWTCCPRPCS | ELFPLIPNDY | LLSWLLFIAF | ||||
LFSGIIYTYG | HVLWKAHQHV | ASLSGHQDRQ | VPGMARMRLD | VRLAKTLGLV | ||||
LAVLLICWFP | VLALMAHSLA | TTLSDQVKKA | FAFCSMLCLI | NSMVNPVIYA | ||||
LRSGEIRSSA | HHCLAHWKKC | VRGLGSEAKE | EAPRSSVTET | EADGKITPWP | ||||
DSRDLDLSDC |
Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, , фосфопротеїнів. Задіяний у таких біологічних процесах як запальна відповідь, поліморфізм. Локалізований у клітинній мембрані, мембрані, клітинних відростках.
Література
- Munro S., Thomas K.L., Abu-Shaar M. (1993). Molecular characterization of a peripheral receptor for cannabinoids. Nature. 365: 61—65. PMID 7689702 DOI:10.1038/365061a0
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Bouaboula M., Dussossoy D., Casellas P. (1999). Regulation of peripheral cannabinoid receptor CB2 phosphorylation by the inverse agonist SR 144528. Implications for receptor biological responses. J. Biol. Chem. 274: 20397—20405. PMID 10400664 DOI:10.1074/jbc.274.29.20397
- Song Z.H., Feng W. (2002). Absence of a conserved proline and presence of a conserved tyrosine in the CB2 cannabinoid receptor are crucial for its function. FEBS Lett. 531: 290—294. PMID 12417328 DOI:10.1016/S0014-5793(02)03537-8
- Feng W., Song Z.H. (2003). Effects of D3.49A, R3.50A, and A6.34E mutations on ligand binding and activation of the cannabinoid-2 (CB2) receptor. Biochem. Pharmacol. 65: 1077—1085. PMID 12663043 DOI:10.1016/S0006-2952(03)00005-4
Примітки
- Сполуки, які фізично взаємодіють з CNR2 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:2160 (англ.) . Процитовано 25 серпня 2017.
- (англ.) . Архів оригіналу за 29 серпня 2017. Процитовано 25 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CNR2 angl Cannabinoid receptor 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 360 aminokislot a molekulyarna masa 39 681 CNR2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB2KI9IdentifikatoriSimvoliCNR2 CB 2 CB2 CX5 Cannabinoid receptor type 2 cannabinoid receptor 2Zovnishni ID OMIM 605051 MGI 104650 HomoloGene 1389 GeneCards CNR2Reaguye na spolukuAM 1241 HU 210 JWH 133 L 759 633 L 759 656 HU 243 win 55212 2 2 Arahidonoyilglicerin Anandamid tetragidrokannabinol 6 iodopravadoline SR144528 TM 38837Ontologiya genaMolekulyarna funkciya G protein coupled receptor activity signal transducer activity cannabinoid receptor activityKlitinna komponenta integral component of membrane perikarion cell projection membrana extrinsic component of cytoplasmic side of plasma membrane klitinna membrana integral component of plasma membrane neuronal cell body dendrit nejrobiologiya neuron projectionBiologichnij proces negative regulation of nitric oxide synthase activity negative regulation of mast cell activation cannabinoid signaling pathway response to amphetamine G protein coupled receptor signaling pathway coupled to cyclic nucleotide second messenger negative regulation of action potential response to lipopolysaccharide negative regulation of synaptic transmission GABAergic GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid sensory perception of pain inflammatory response negative regulation of inflammatory response GO 0072468 signalna transdukciya leukocyte chemotaxis G protein coupled receptor signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1269 12802Ensembl ENSG00000188822 ENSMUSG00000062585UniProt P34972 P47936RefSeq mRNK NM 001841NM 009924 NM 001305278RefSeq bilok NP 001832NP 001292207 NP 034054Lokus UCSC Hr 1 23 87 23 91 MbHr 4 135 62 135 65 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDCA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv g bilokspryazhenih receptoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak zapalna vidpovid polimorfizm Lokalizovanij u klitinnij membrani membrani klitinnih vidrostkah LiteraturaMunro S Thomas K L Abu Shaar M 1993 Molecular characterization of a peripheral receptor for cannabinoids Nature 365 61 65 PMID 7689702 DOI 10 1038 365061a0 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Bouaboula M Dussossoy D Casellas P 1999 Regulation of peripheral cannabinoid receptor CB2 phosphorylation by the inverse agonist SR 144528 Implications for receptor biological responses J Biol Chem 274 20397 20405 PMID 10400664 DOI 10 1074 jbc 274 29 20397 Song Z H Feng W 2002 Absence of a conserved proline and presence of a conserved tyrosine in the CB2 cannabinoid receptor are crucial for its function FEBS Lett 531 290 294 PMID 12417328 DOI 10 1016 S0014 5793 02 03537 8 Feng W Song Z H 2003 Effects of D3 49A R3 50A and A6 34E mutations on ligand binding and activation of the cannabinoid 2 CB2 receptor Biochem Pharmacol 65 1077 1085 PMID 12663043 DOI 10 1016 S0006 2952 03 00005 4PrimitkiSpoluki yaki fizichno vzayemodiyut z CNR2 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 2160 angl Procitovano 25 serpnya 2017 angl Arhiv originalu za 29 serpnya 2017 Procitovano 25 serpnya 2017 Div takozhHromosoma 1 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi