Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

CASP9 англ Caspase 9 білок який кодується однойменним геном розташованим у людей на короткому плечі 1 ї хромосоми Довжин

CASP9

CASP9

CASP9 (англ. Caspase 9) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 416 амінокислот, а молекулярна маса — 46 281.

CASP9
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CASP9, APAF-3, APAF3, ICE-LAP6, MCH6, PPP1R56, caspase 9
Зовнішні ІД OMIM: 602234 MGI: 1277950 HomoloGene: 31024 GeneCards: CASP9
Реагує на сполуку
emricasan
Шаблон експресії
image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
842
12371
Ensembl
ENSG00000132906
ENSMUSG00000028914
UniProt
P55211
Q8C3Q9
RefSeq (мРНК)
NM_001229
NM_001278054
NM_032996
NM_001277932
NM_015733
NM_001355176
RefSeq (білок)
NP_001220
NP_001264983
NP_127463
NP_001264861
NP_056548
NP_001342105
Локус (UCSC) Хр. 1: 15.49 – 15.53 Mb Хр. 4: 141.52 – 141.54 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGS
RRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSK
PTLENLTPVVLRPEIRKPEVLRPETPRPVDIGSGGFGDVGALESLRGNAD
LAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFM
VEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQASHLQFPGAV
YGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVAS
TSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPG
FVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQM
PGCFNFLRKKLFFKTS

Кодований геном білок за функціями належить до гідролаз, протеаз, тіолових протеаз. Задіяний у такому біологічному процесі як апоптоз.

Література

  • Seol D.W., Billiar T.R. (1999). A caspase-9 variant missing the catalytic site is an endogenous inhibitor of apoptosis. J. Biol. Chem. 274: 2072—2076. PMID 9890966 DOI:10.1074/jbc.274.4.2072
  • Wang P., Shi T., Ma D. (2006). Cloning of a novel human caspase-9 splice variant containing only the CARD domain. Life Sci. 79: 934—940. PMID 16780893 DOI:10.1016/j.lfs.2006.04.026
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Bartke T., Pohl C., Pyrowolakis G., Jentsch S. (2004). Dual role of BRUCE as an antiapoptotic IAP and a chimeric E2/E3 ubiquitin ligase. Mol. Cell. 14: 801—811. PMID 15200957 DOI:10.1016/j.molcel.2004.05.018
  • Checinska A., Giaccone G., Rodriguez J.A., Kruyt F.A.E., Jimenez C.R. (2009). Comparative proteomics analysis of caspase-9-protein complexes in untreated and cytochrome c/dATP stimulated lysates of NSCLC cells. J. Proteomics. 72: 575—585. PMID 19118655 DOI:10.1016/j.jprot.2008.11.016
  • Renatus M., Stennicke H.R., Scott F.L., Liddington R.C., Salvesen G.S. (2001). Dimer formation drives the activation of the cell death protease caspase 9. Proc. Natl. Acad. Sci. U.S.A. 98: 14250—14255. PMID 11734640 DOI:10.1073/pnas.231465798

Примітки

  1. Сполуки, які фізично взаємодіють з Caspase 9 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:1511 (англ.) . Процитовано 25 серпня 2017.
  5. (англ.) . Архів оригіналу за 16 серпня 2017. Процитовано 25 серпня 2017.

Див. також


image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

CASP9 angl Caspase 9 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 416 aminokislot a molekulyarna masa 46 281 CASP9Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB4RHW 1JXQ 1NW9 2AR9 3D9T 3V3K 3YGSIdentifikatoriSimvoliCASP9 APAF 3 APAF3 ICE LAP6 MCH6 PPP1R56 caspase 9Zovnishni ID OMIM 602234 MGI 1277950 HomoloGene 31024 GeneCards CASP9Reaguye na spolukuemricasan Ontologiya genaMolekulyarna funkciya cysteine type peptidase activity SH3 domain binding GO 0070122 peptidase activity GO 0001948 GO 0016582 protein binding GO 0010577 enzyme activator activity hydrolase activity protein kinase binding cysteine type endopeptidase activity involved in execution phase of apoptosis cysteine type endopeptidase activity identical protein binding cysteine type endopeptidase activity involved in apoptotic signaling pathway cysteine type endopeptidase activity involved in apoptotic processKlitinna komponenta citoplazma gialoplazma mitohondriya apoptosome klitinne yadro GO 0009327 protein containing complexBiologichnij proces regulation of apoptotic process response to estradiol GO 1904578 response to organic cyclic compound signal transduction in response to DNA damage cellular response to UV GO 1904576 response to antibiotic GO 1904579 cellular response to organic cyclic compound GO 0010260 starinnya lyudini Trombocitopoez glial cell apoptotic process cellular response to dexamethasone stimulus proteoliz cellular response to DNA damage stimulus response to lipopolysaccharide positive regulation of neuron apoptotic process activation of cysteine type endopeptidase activity involved in apoptotic process by cytochrome c intrinsic apoptotic signaling pathway in response to DNA damage extrinsic apoptotic signaling pathway in absence of ligand regulation of response to DNA damage stimulus response to cobalt ion activation of cysteine type endopeptidase activity involved in apoptotic process response to UV execution phase of apoptosis positive regulation of apoptotic process GO 0097285 apoptoz rozvitok nirki response to ischemia leukocyte apoptotic processDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez842 12371Ensembl ENSG00000132906 ENSMUSG00000028914UniProt P55211 Q8C3Q9RefSeq mRNK NM 001229 NM 001278054 NM 032996NM 001277932 NM 015733 NM 001355176RefSeq bilok NP 001220 NP 001264983 NP 127463NP 001264861 NP 056548 NP 001342105Lokus UCSC Hr 1 15 49 15 53 MbHr 4 141 52 141 54 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGS RRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSK PTLENLTPVVLRPEIRKPEVLRPETPRPVDIGSGGFGDVGALESLRGNAD LAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFM VEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQASHLQFPGAV YGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVAS TSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPG FVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQM PGCFNFLRKKLFFKTS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do gidrolaz proteaz tiolovih proteaz Zadiyanij u takomu biologichnomu procesi yak apoptoz LiteraturaSeol D W Billiar T R 1999 A caspase 9 variant missing the catalytic site is an endogenous inhibitor of apoptosis J Biol Chem 274 2072 2076 PMID 9890966 DOI 10 1074 jbc 274 4 2072 Wang P Shi T Ma D 2006 Cloning of a novel human caspase 9 splice variant containing only the CARD domain Life Sci 79 934 940 PMID 16780893 DOI 10 1016 j lfs 2006 04 026 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Bartke T Pohl C Pyrowolakis G Jentsch S 2004 Dual role of BRUCE as an antiapoptotic IAP and a chimeric E2 E3 ubiquitin ligase Mol Cell 14 801 811 PMID 15200957 DOI 10 1016 j molcel 2004 05 018 Checinska A Giaccone G Rodriguez J A Kruyt F A E Jimenez C R 2009 Comparative proteomics analysis of caspase 9 protein complexes in untreated and cytochrome c dATP stimulated lysates of NSCLC cells J Proteomics 72 575 585 PMID 19118655 DOI 10 1016 j jprot 2008 11 016 Renatus M Stennicke H R Scott F L Liddington R C Salvesen G S 2001 Dimer formation drives the activation of the cell death protease caspase 9 Proc Natl Acad Sci U S A 98 14250 14255 PMID 11734640 DOI 10 1073 pnas 231465798PrimitkiSpoluki yaki fizichno vzayemodiyut z Caspase 9 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1511 angl Procitovano 25 serpnya 2017 angl Arhiv originalu za 16 serpnya 2017 Procitovano 25 serpnya 2017 Div takozhHromosoma 1 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ