CASP8 (англ. Caspase 8) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми людини. Довжина поліпептидного ланцюга білка становить 479 амінокислот, а молекулярна маса — 55 391.
CASP8 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CASP8, ALPS2B, CAP4, Casp-8, FLICE, MACH, MCH5, caspase 8 | ||||||||||||||||
Зовнішні ІД | OMIM: 601763 MGI: 1261423 HomoloGene: 7657 GeneCards: CASP8 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
caspase-8 deficiency | |||||||||||||||||
Реагує на сполуку | |||||||||||||||||
emricasan | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 2: 201.23 – 201.29 Mb | Хр. 1: 58.83 – 58.89 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MDFSRNLYDI | GEQLDSEDLA | SLKFLSLDYI | PQRKQEPIKD | ALMLFQRLQE | ||||
KRMLEESNLS | FLKELLFRIN | RLDLLITYLN | TRKEEMEREL | QTPGRAQISA | ||||
YRVMLYQISE | EVSRSELRSF | KFLLQEEISK | CKLDDDMNLL | DIFIEMEKRV | ||||
ILGEGKLDIL | KRVCAQINKS | LLKIINDYEE | FSKERSSSLE | GSPDEFSNGE | ||||
ELCGVMTISD | SPREQDSESQ | TLDKVYQMKS | KPRGYCLIIN | NHNFAKAREK | ||||
VPKLHSIRDR | NGTHLDAGAL | TTTFEELHFE | IKPHDDCTVE | QIYEILKIYQ | ||||
LMDHSNMDCF | ICCILSHGDK | GIIYGTDGQE | APIYELTSQF | TGLKCPSLAG | ||||
KPKVFFIQAC | QGDNYQKGIP | VETDSEEQPY | LEMDLSSPQT | RYIPDEADFL | ||||
LGMATVNNCV | SYRNPAEGTW | YIQSLCQSLR | ERCPRGDDIL | TILTEVNYEV | ||||
SNKDDKKNMG | KQMPQPTFTL | RKKLVFPSD |
Член родини каспаз, задіяний у таких біологічних процесах як апоптоз, взаємодія хазяїн-вірус, поліморфізм, ацетилювання, альтернативний сплайсинг. Локалізований у цитоплазмі.
За функціями належить до протеаз, а саме групи тіолових протеаз, також є фосфопротеїном.
Література
- Boldin M.P., Goncharov T.M., Goltsev Y.V., Wallach D. (1996). Involvement of MACH, a novel MORT1/FADD-interacting protease, in Fas/APO-1- and TNF receptor-induced cell death. Cell. 85: 803—815. PMID 8681376 DOI:10.1016/S0092-8674(00)81265-9
- Grenet J., Teitz T., Wei T., Valentine V., Kidd V.J. (1999). Structure and chromosome localization of the human CASP8 gene. Gene. 226: 225—232. PMID 9931493 DOI:10.1016/S0378-1119(98)00565-4
- Breckenridge D.G., Nguyen M., Kuppig S., Reth M., Shore G.C. (2002). The procaspase-8 isoform, procaspase-8L, recruited to the BAP31 complex at the endoplasmic reticulum. Proc. Natl. Acad. Sci. U.S.A. 99: 4331—4336. PMID 11917123 DOI:10.1073/pnas.072088099
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Srinivasula S.M., Ahmad M., Fernandes-Alnemri T., Litwack G., Alnemri E.S. (1996). Molecular ordering of the Fas-apoptotic pathway: the Fas/APO-1 protease Mch5 is a CrmA-inhibitable protease that activates multiple Ced-3/ICE-like cysteine proteases. Proc. Natl. Acad. Sci. U.S.A. 93: 14486—14491. PMID 8962078 DOI:10.1073/pnas.93.25.14486
- Muzio M., Salvesen G.S., Dixit V.M. (1997). FLICE induced apoptosis in a cell-free system. Cleavage of caspase zymogens. J. Biol. Chem. 272: 2952—2956. PMID 9006941 DOI:10.1074/jbc.272.5.2952
Примітки
- Захворювання, генетично пов'язані з CASP8 переглянути/редагувати посилання на ВікіДаних.
- Сполуки, які фізично взаємодіють з Caspase 8 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 2 вересня 2017. Процитовано 28 серпня 2017.
- (англ.) . Архів оригіналу за 29 серпня 2017. Процитовано 28 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CASP8 angl Caspase 8 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 2 yi hromosomi lyudini Dovzhina polipeptidnogo lancyuga bilka stanovit 479 aminokislot a molekulyarna masa 55 391 CASP8Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1F9E 1I4E 1QDU 1QTN 2C2Z 2FUN 2K7Z 2Y1L 3H11 3KJN 3KJQ 4JJ7 4PRZ 4PS1 4ZBWIdentifikatoriSimvoliCASP8 ALPS2B CAP4 Casp 8 FLICE MACH MCH5 caspase 8Zovnishni ID OMIM 601763 MGI 1261423 HomoloGene 7657 GeneCards CASP8Pov yazani genetichni zahvoryuvannyacaspase 8 deficiency Reaguye na spolukuemricasan Ontologiya genaMolekulyarna funkciya death effector domain binding cysteine type peptidase activity cysteine type endopeptidase activity involved in apoptotic signaling pathway scaffold protein binding GO 0001948 GO 0016582 protein binding identical protein binding cysteine type endopeptidase activity involved in apoptotic process cysteine type endopeptidase activity hydrolase activity ubiquitin protein ligase binding GO 0070122 peptidase activity cysteine type endopeptidase activity involved in execution phase of apoptosis death receptor binding tumor necrosis factor receptor binding GO 0032403 protein containing complex bindingKlitinna komponenta cell body gialoplazma CD95 death inducing signaling complex ripoptosome nukleoplazma mitohondrialna zovnishnya membrana death inducing signaling complex membrane raft neuron projection citoskelet citoplazma mitohondriya klitinne yadro GO 0009327 protein containing complexBiologichnij proces regulation of apoptotic process response to estradiol activation of cysteine type endopeptidase activity involved in apoptotic signaling pathway GO 1904576 response to antibiotic regulation of tumor necrosis factor mediated signaling pathway positive regulation of macrophage differentiation GO 1904579 cellular response to organic cyclic compound natural killer cell activation negative regulation of I kappaB kinase NF kappaB signaling TRAIL activated apoptotic signaling pathway proteoliz macrophage differentiation TRIF dependent toll like receptor signaling pathway response to tumor necrosis factor B cell activation cell surface receptor signaling pathway response to lipopolysaccharide cellular response to mechanical stimulus activation of cysteine type endopeptidase activity positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway death inducing signaling complex assembly positive regulation of proteolysis positive regulation of I kappaB kinase NF kappaB signaling apoptotic signaling pathway response to cold regulation of extrinsic apoptotic signaling pathway via death domain receptors GO 0022415 viral process response to ethanol response to cobalt ion activation of cysteine type endopeptidase activity involved in apoptotic process proteolysis involved in cellular protein catabolic process syncytiotrophoblast cell differentiation involved in labyrinthine layer development nucleotide binding oligomerization domain containing signaling pathway T cell activation suppression by virus of host cysteine type endopeptidase activity involved in apoptotic process GO 0097285 apoptoz extrinsic apoptotic signaling pathway negative regulation of extrinsic apoptotic signaling pathway via death domain receptors regulation of necroptotic process execution phase of apoptosis toll like receptor 3 signaling pathway positive regulation of neuron death extrinsic apoptotic signaling pathway via death domain receptors positive regulation of interleukin 1 beta productionDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez841 12370Ensembl ENSG00000064012 ENSMUSG00000026029UniProt Q14790 O89110RefSeq mRNK NM 001080124 NM 001080125 NM 001228 NM 033355 NM 033356NM 033357 NM 033358 NM 001372051NM 001080126 NM 001277926 NM 009812RefSeq bilok NP 001073593 NP 001073594 NP 001219 NP 203519 NP 203520NP 203522 NP 001358980NP 001073595 NP 001264855 NP 033942Lokus UCSC Hr 2 201 23 201 29 MbHr 1 58 83 58 89 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQE KRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISA YRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRV ILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGE ELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREK VPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQ LMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAG KPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFL LGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEV SNKDDKKNMGKQMPQPTFTLRKKLVFPSD A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Chlen rodini kaspaz zadiyanij u takih biologichnih procesah yak apoptoz vzayemodiya hazyayin virus polimorfizm acetilyuvannya alternativnij splajsing Lokalizovanij u citoplazmi Za funkciyami nalezhit do proteaz a same grupi tiolovih proteaz takozh ye fosfoproteyinom LiteraturaBoldin M P Goncharov T M Goltsev Y V Wallach D 1996 Involvement of MACH a novel MORT1 FADD interacting protease in Fas APO 1 and TNF receptor induced cell death Cell 85 803 815 PMID 8681376 DOI 10 1016 S0092 8674 00 81265 9 Grenet J Teitz T Wei T Valentine V Kidd V J 1999 Structure and chromosome localization of the human CASP8 gene Gene 226 225 232 PMID 9931493 DOI 10 1016 S0378 1119 98 00565 4 Breckenridge D G Nguyen M Kuppig S Reth M Shore G C 2002 The procaspase 8 isoform procaspase 8L recruited to the BAP31 complex at the endoplasmic reticulum Proc Natl Acad Sci U S A 99 4331 4336 PMID 11917123 DOI 10 1073 pnas 072088099 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Srinivasula S M Ahmad M Fernandes Alnemri T Litwack G Alnemri E S 1996 Molecular ordering of the Fas apoptotic pathway the Fas APO 1 protease Mch5 is a CrmA inhibitable protease that activates multiple Ced 3 ICE like cysteine proteases Proc Natl Acad Sci U S A 93 14486 14491 PMID 8962078 DOI 10 1073 pnas 93 25 14486 Muzio M Salvesen G S Dixit V M 1997 FLICE induced apoptosis in a cell free system Cleavage of caspase zymogens J Biol Chem 272 2952 2956 PMID 9006941 DOI 10 1074 jbc 272 5 2952PrimitkiZahvoryuvannya genetichno pov yazani z CASP8 pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z Caspase 8 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 2 veresnya 2017 Procitovano 28 serpnya 2017 angl Arhiv originalu za 29 serpnya 2017 Procitovano 28 serpnya 2017 Div takozhHromosoma 2 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi