Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

BID англ BH3 interacting domain death agonist білок який кодується однойменним геном розташованим у людей на короткому п

BID

BID

BID (англ. BH3 interacting domain death agonist) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми. Довжина поліпептидного ланцюга білка становить 195 амінокислот, а молекулярна маса — 21 995.

BID
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи BID, Bid, 2700049M22Rik, AI875481, AU022477, FP497, BH3 interacting domain death agonist
Зовнішні ІД OMIM: 601997 MGI: 108093 HomoloGene: 923 GeneCards: BID
Шаблон експресії
image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
637
12122
Ensembl
ENSG00000015475
ENSMUSG00000004446
UniProt
P55957
P70444
RefSeq (мРНК)
NM_007544
RefSeq (білок)
NP_031570
Локус (UCSC) Хр. 22: 17.73 – 17.77 Mb Хр. 6: 120.87 – 120.89 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQ
WEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRS
IPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLV
LALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, ацетилювання, альтернативний сплайсинг. Локалізований у цитоплазмі, мембрані, мітохондрії.

Література

  • Wang K., Yin X.-M., Chao D.T., Milliman C.L., Korsmeyer S.J. (1996). BID: a novel BH3 domain-only death agonist. Genes Dev. 10: 2859—2869. PMID 8918887 DOI:10.1101/gad.10.22.2859
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Azakir B.A., Desrochers G., Angers A. (2010). The ubiquitin ligase Itch mediates the antiapoptotic activity of epidermal growth factor by promoting the ubiquitylation and degradation of the truncated C-terminal portion of Bid. FEBS J. 277: 1319—1330. PMID 20392206 DOI:10.1111/j.1742-4658.2010.07562.x
  • Chou J.J., Li H., Salvesen G.S., Yuan J., Wagner G. (1999). Solution structure of BID, an intracellular amplifier of apoptotic signaling. Cell. 96: 615—624. PMID 10089877 DOI:10.1016/S0092-8674(00)80572-3

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. (англ.) . Архів оригіналу за 16 липня 2017. Процитовано 12 вересня 2017.
  4. (англ.) . Архів оригіналу за 20 липня 2017. Процитовано 12 вересня 2017.

Див. також


image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

BID angl BH3 interacting domain death agonist bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 22 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 195 aminokislot a molekulyarna masa 21 995 BIDNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1ZY3 2BID 2KBW 2M5B 2M5I 4BD2 4ZEQ 5AJJ 4QVE 4ZIG 4ZII 5C3FIdentifikatoriSimvoliBID Bid 2700049M22Rik AI875481 AU022477 FP497 BH3 interacting domain death agonistZovnishni ID OMIM 601997 MGI 108093 HomoloGene 923 GeneCards BIDOntologiya genaMolekulyarna funkciya death receptor binding GO 0001948 GO 0016582 protein binding ubiquitin protein ligase binding protein heterodimerization activityKlitinna komponenta citoplazma membrana mitohondrialna membrana mitohondrialna zovnishnya membrana mitohondriya integral component of mitochondrial membrane gialoplazmaBiologichnij proces neuron apoptotic process positive regulation of protein homooligomerization positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway extrinsic apoptotic signaling pathway signal transduction in response to DNA damage regulation of protein oligomerization establishment of protein localization to membrane protein targeting to mitochondrion regulation of mitochondrial membrane permeability involved in apoptotic process regulation of G1 S transition of mitotic cell cycle positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway regulation of cell population proliferation apoptotic mitochondrial changes positive regulation of protein oligomerization positive regulation of apoptotic process positive regulation of release of cytochrome c from mitochondria positive regulation of extrinsic apoptotic signaling pathway protein homooligomerization activation of cysteine type endopeptidase activity involved in apoptotic process mitochondrial outer membrane permeabilization extrinsic apoptotic signaling pathway via death domain receptors hepatocyte apoptotic process release of cytochrome c from mitochondria GO 0097285 apoptoz regulation of apoptotic process positive regulation of mitochondrial membrane potential mitochondrial ATP synthesis coupled electron transport negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage positive regulation of fibroblast apoptotic process positive regulation of apoptotic signaling pathway negative regulation of apoptotic process positive regulation of intrinsic apoptotic signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez637 12122Ensembl ENSG00000015475 ENSMUSG00000004446UniProt P55957 P70444RefSeq mRNK NM 001196 NM 001244567 NM 001244569 NM 001244570 NM 001244572NM 197966 NM 197967NM 007544RefSeq bilok NP 001187 NP 001231496 NP 001231498 NP 001231499 NP 001231501NP 932070 NP 932071 NP 001187 1 NP 001231496 1NP 031570Lokus UCSC Hr 22 17 73 17 77 MbHr 6 120 87 120 89 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQ WEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRS IPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLV LALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak apoptoz acetilyuvannya alternativnij splajsing Lokalizovanij u citoplazmi membrani mitohondriyi LiteraturaWang K Yin X M Chao D T Milliman C L Korsmeyer S J 1996 BID a novel BH3 domain only death agonist Genes Dev 10 2859 2869 PMID 8918887 DOI 10 1101 gad 10 22 2859 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Azakir B A Desrochers G Angers A 2010 The ubiquitin ligase Itch mediates the antiapoptotic activity of epidermal growth factor by promoting the ubiquitylation and degradation of the truncated C terminal portion of Bid FEBS J 277 1319 1330 PMID 20392206 DOI 10 1111 j 1742 4658 2010 07562 x Chou J J Li H Salvesen G S Yuan J Wagner G 1999 Solution structure of BID an intracellular amplifier of apoptotic signaling Cell 96 615 624 PMID 10089877 DOI 10 1016 S0092 8674 00 80572 3PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 16 lipnya 2017 Procitovano 12 veresnya 2017 angl Arhiv originalu za 20 lipnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 22 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ