Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
BCL2L1 (англ. BCL2 like 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми. Довжина поліпептидного ланцюга білка становить 233 амінокислот, а молекулярна маса — 26 049.
| BCL2L1 | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
 | |||||||||||||||||
| |||||||||||||||||
| Ідентифікатори | |||||||||||||||||
| Символи | BCL2L1, Bcl2l1, Bcl(X)L, Bcl-XL, Bcl2l, BclX, bcl-x, bcl2-L-1, BCL-XL/S, BCLXL, BCLXS, PPP1R52, bcl-xS, BCL2L, BCLX, Bcl-X, bcl-xL, BCL2 like 1 | ||||||||||||||||
| Зовнішні ІД | OMIM: 600039 MGI: 88139 HomoloGene: 7639 GeneCards: BCL2L1 | ||||||||||||||||
| Реагує на сполуку | |||||||||||||||||
| navitoclax | |||||||||||||||||
| |||||||||||||||||
| Шаблон експресії | |||||||||||||||||
   | |||||||||||||||||
| Більше даних | |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 20: 31.66 – 31.72 Mb | Хр. 2: 152.62 – 152.67 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MSQSNRELVV | DFLSYKLSQK | GYSWSQFSDV | EENRTEAPEG | TESEMETPSA | ||||
| INGNPSWHLA | DSPAVNGATG | HSSSLDAREV | IPMAAVKQAL | REAGDEFELR | ||||
| YRRAFSDLTS | QLHITPGTAY | QSFEQVVNEL | FRDGVNWGRI | VAFFSFGGAL | ||||
| CVESVDKEMQ | VLVSRIAAWM | ATYLNDHLEP | WIQENGGWDT | FVELYGNNAA | ||||
| AESRKGQERF | NRWFLTGMTV | AGVVLLGSLF | SRK |
Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, ендоцитоз, альтернативний сплайсинг. Локалізований у цитоплазмі, цитоскелеті, ядрі, мембрані, мітохондрії, внутрішній мембрані мітохондрії, клітинних контактах, цитоплазматичних везикулах, зовнішній мембрані мітохондрій, синапсах.
Література
- Ban J., Eckhart L., Weninger W., Mildner M., Tschachler E. (1998). Identification of a human cDNA encoding a novel Bcl-x isoform. Biochem. Biophys. Res. Commun. 248: 147—152. PMID 9675101 DOI:10.1006/bbrc.1998.8907
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Schmitt E., Paquet C., Beauchemin M., Dever-Bertrand J., Bertrand R. (2000). Characterization of Bax-sigma, a cell death-inducing isoform of Bax. Biochem. Biophys. Res. Commun. 270: 868—879. PMID 10772918 DOI:10.1006/bbrc.2000.2537
- Rebollo A., Ayllon V., Fleischer A., Martinez C.A., Zaballos A. (2001). The association of Aiolos transcription factor and Bcl-xL is involved in the control of apoptosis. J. Immunol. 167: 6366—6373. PMID 11714801 DOI:10.4049/jimmunol.167.11.6366
- Yu J., Zhang L., Hwang P.M., Kinzler K.W., Vogelstein B. (2001). PUMA induces the rapid apoptosis of colorectal cancer cells. Mol. Cell. 7: 673—682. PMID 11463391 DOI:10.1016/S1097-2765(01)00213-1
- Lo S.-C., Hannink M. (2006). PGAM5, a Bcl-XL-interacting protein, is a novel substrate for the redox-regulated Keap1-dependent ubiquitin ligase complex. J. Biol. Chem. 281: 37893—37903. PMID 17046835 DOI:10.1074/jbc.M606539200
Примітки
- Сполуки, які фізично взаємодіють з BCL2 like 1 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:992 (англ.) . Архів оригіналу за 16 липня 2017. Процитовано 12 вересня 2017. [Архівовано 2017-07-16 у Wayback Machine.]
- UniProt, Q07817 (англ.) . Архів оригіналу за 12 вересня 2017. Процитовано 12 вересня 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
BCL2L1 angl BCL2 like 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 20 yi hromosomi 4 Dovzhina polipeptidnogo lancyuga bilka stanovit 233 aminokislot a molekulyarna masa 26 049 5 BCL2L1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1BXL 1G5J 1LXL 1MAZ 1R2D 1R2E 1R2G 1R2H 1R2I 1YSG 1YSI 1YSN 2B48 2LP8 2LPC 2M03 2M04 2ME8 2ME9 2MEJ 2O1Y 2O2M 2O2N 2P1L 2PON 2YJ1 2YQ6 2YQ7 2YXJ 3CVA 3FDL 3FDM 3INQ 3IO8 3PL7 3QKD 3R85 3SP7 3SPF 3WIZ 3ZK6 3ZLN 3ZLO 3ZLR 4A1U 4A1W 4AQ3 4BPK 4C52 4C5D 4CIN 4EHR 4HNJ 4IEH 4PPI 4QVE 4QVF 4QVX 4TUH 5AGW 5AGX 4Z9V 5FMK 5FMJ 5C3GIdentifikatoriSimvoliBCL2L1 Bcl2l1 Bcl X L Bcl XL Bcl2l BclX bcl x bcl2 L 1 BCL XL S BCLXL BCLXS PPP1R52 bcl xS BCL2L BCLX Bcl X bcl xL BCL2 like 1Zovnishni ID OMIM 600039 MGI 88139 HomoloGene 7639 GeneCards BCL2L1Reaguye na spolukunavitoclax 1 Ontologiya genaMolekulyarna funkciya BH3 domain binding GO 0001948 GO 0016582 protein binding identical protein binding protein kinase binding protein homodimerization activity protein heterodimerization activityKlitinna komponenta citoplazma integral component of membrane gialoplazma centrosoma yaderna membrana mitohondrialna membrana membrana Bcl 2 family protein complex sinaps vnutrishnoklitinnij synaptic vesicle membrane centr organizaciyi mikrotrubochok mizhklitinni kontakti mitohondrialnij matriks mitohondriya mitohondrialna vnutrishnya membrana citoskelet GO 0016023 cytoplasmic vesicle klitinne yadro endoplazmatichnij retikulum mitohondrialna zovnishnya membranaBiologichnij proces GO 1904089 negative regulation of neuron apoptotic process neuron apoptotic process germ cell development negative regulation of execution phase of apoptosis regulation of apoptotic process response to cytokine male gonad development endocitoz negative regulation of intrinsic apoptotic signaling pathway mitotic cell cycle checkpoint signaling negative regulation of release of cytochrome c from mitochondria response to virus negative regulation of apoptotic process response to cycloheximide in utero embryonic development cellular response to alkaloid negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage regulation of mitochondrial membrane potential regulation of mitochondrial membrane permeability apoptotic mitochondrial changes cellular response to gamma radiation Spermatogenez positive regulation of cell population proliferation positive regulation of apoptotic process cellular response to amino acid stimulus ovarian follicle development apoptotic process in bone marrow cell zaplidnennya response to radiation suppression by virus of host apoptotic process proliferaciya mitochondrion morphogenesis negative regulation of extrinsic apoptotic signaling pathway in absence of ligand negative regulation of autophagy positive regulation of intrinsic apoptotic signaling pathway negative regulation of anoikis hepatocyte apoptotic process release of cytochrome c from mitochondria intrinsic apoptotic signaling pathway in response to DNA damage extrinsic apoptotic signaling pathway in absence of ligand GO 0097285 apoptoz negative regulation of extrinsic apoptotic signaling pathway via death domain receptors rist negative regulation of protein localization to plasma membrane cytokine mediated signaling pathway regulation of cytokinesis regulation of growth negative regulation of endoplasmic reticulum stress induced intrinsic apoptotic signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez598 12048Ensembl ENSG00000171552 ENSMUSG00000007659UniProt Q07817 Q5TE64 Q64373RefSeq mRNK NM 001191 NM 138578 NM 001317919 NM 001317920 NM 001317921NM 001322239 NM 001322240 NM 001322242NM 001289716 NM 001289717 NM 001289739 NM 009743 NM 001355053RefSeq bilok NP 001182 NP 001304848 NP 001304849 NP 001304850 NP 001309168NP 001309169 NP 001309171 NP 612815NP 001276645 NP 001276646 NP 001276668 NP 033873 NP 001341982Lokus UCSC Hr 20 31 66 31 72 MbHr 2 152 62 152 67 MbPubMed search 2 3 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak apoptoz endocitoz alternativnij splajsing Lokalizovanij u citoplazmi citoskeleti yadri membrani mitohondriyi vnutrishnij membrani mitohondriyi klitinnih kontaktah citoplazmatichnih vezikulah zovnishnij membrani mitohondrij sinapsah Literaturared Ban J Eckhart L Weninger W Mildner M Tschachler E 1998 Identification of a human cDNA encoding a novel Bcl x isoform Biochem Biophys Res Commun 248 147 152 PMID 9675101 DOI 10 1006 bbrc 1998 8907 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Schmitt E Paquet C Beauchemin M Dever Bertrand J Bertrand R 2000 Characterization of Bax sigma a cell death inducing isoform of Bax Biochem Biophys Res Commun 270 868 879 PMID 10772918 DOI 10 1006 bbrc 2000 2537 Rebollo A Ayllon V Fleischer A Martinez C A Zaballos A 2001 The association of Aiolos transcription factor and Bcl xL is involved in the control of apoptosis J Immunol 167 6366 6373 PMID 11714801 DOI 10 4049 jimmunol 167 11 6366 Yu J Zhang L Hwang P M Kinzler K W Vogelstein B 2001 PUMA induces the rapid apoptosis of colorectal cancer cells Mol Cell 7 673 682 PMID 11463391 DOI 10 1016 S1097 2765 01 00213 1 Lo S C Hannink M 2006 PGAM5 a Bcl XL interacting protein is a novel substrate for the redox regulated Keap1 dependent ubiquitin ligase complex J Biol Chem 281 37893 37903 PMID 17046835 DOI 10 1074 jbc M606539200Primitkired Spoluki yaki fizichno vzayemodiyut z BCL2 like 1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 992 angl Arhiv originalu za 16 lipnya 2017 Procitovano 12 veresnya 2017 Arhivovano 2017 07 16 u Wayback Machine UniProt Q07817 angl Arhiv originalu za 12 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhred Hromosoma 20 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title BCL2L1 amp oldid 43982824