Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

BCL2 англ BCL2 apoptosis regulator білок який кодується однойменним геном розташованим у людей на короткому плечі 18 ї х

BCL2

BCL2

BCL2 (англ. BCL2, apoptosis regulator) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 18-ї хромосоми. Довжина поліпептидного ланцюга білка становить 239 амінокислот, а молекулярна маса — 26 266.

BCL2
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи BCL2, Bcl-2, PPP1R50, B-cell CLL/lymphoma 2, apoptosis regulator, BCL2 apoptosis regulator, Genes, bcl-2
Зовнішні ІД OMIM: 151430 MGI: 88138 HomoloGene: 527 GeneCards: BCL2
Пов'язані генетичні захворювання
хронічний лімфолейкоз, хронічний лімфолейкоз
Реагує на сполуку
navitoclax, navitoclax, venetoclax
Шаблон експресії
image

image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
596
12043
Ensembl
ENSG00000171791
ENSMUSG00000057329
UniProt
P10415
P10417
RefSeq (мРНК)
NM_000633
NM_000657
NM_009741
NM_177410
RefSeq (білок)
NP_000624
NP_000648
NP_033871
NP_803129
Локус (UCSC) Хр. 18: 63.12 – 63.32 Mb Хр. 1: 106.47 – 106.64 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFS
SQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQA
GDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAF
FEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVE
LYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, альтернативний сплайсинг. Локалізований у ядрі, мембрані, мітохондрії, ендоплазматичному ретикулумі, зовнішній мембрані мітохондрій.

Література

  • Tsujimoto Y., Croce C.M. (1986). Analysis of the structure, transcripts, and protein products of bcl-2, the gene involved in human follicular lymphoma. Proc. Natl. Acad. Sci. U.S.A. 83: 5214—5218. PMID 3523487 DOI:10.1073/pnas.83.14.5214
  • Eguchi Y., Ewert D.L., Tsujimoto Y. (1992). Isolation and characterization of the chicken bcl-2 gene: expression in a variety of tissues including lymphoid and neuronal organs in adult and embryo. Nucleic Acids Res. 20: 4187—4192. PMID 1508712 DOI:10.1093/nar/20.16.4187
  • Cleary M.L., Smith S.D., Sklar J. (1986). Cloning and structural analysis of cDNAs for bcl-2 and a hybrid bcl-2/immunoglobulin transcript resulting from the t(14;18) translocation. Cell. 47: 19—28. PMID 2875799 DOI:10.1016/0092-8674(86)90362-4
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Hockenbery D., Nunez G., Milliman C., Schreiber R.D., Korsmeyer S.J. (1990). Bcl-2 is an inner mitochondrial membrane protein that blocks programmed cell death. Nature. 348: 334—336. PMID 2250705 DOI:10.1038/348334a0
  • Yin X.-M., Oltvai Z.N., Korsmeyer S.J. (1994). BH1 and BH2 domains of Bcl-2 are required for inhibition of apoptosis and heterodimerization with Bax. Nature. 369: 321—323. PMID 8183370 DOI:10.1038/369321a0

Примітки

  1. Захворювання, генетично пов'язані з BCL2 переглянути/редагувати посилання на ВікіДаних.
  2. Сполуки, які фізично взаємодіють з BCL2 переглянути/редагувати посилання на ВікіДаних.
  3. Human PubMed Reference:.
  4. Mouse PubMed Reference:.
  5. (англ.) . Архів оригіналу за 16 липня 2017. Процитовано 12 вересня 2017.
  6. (англ.) . Архів оригіналу за 13 вересня 2017. Процитовано 12 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

BCL2 angl BCL2 apoptosis regulator bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 18 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 239 aminokislot a molekulyarna masa 26 266 BCL2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1G5M 1GJH 1YSW 2O21 2O22 2O2F 2W3L 2XA0 4AQ3 4IEH 4LVT 4LXD 4MAN 5AGW 5AGX 5FCGIdentifikatoriSimvoliBCL2 Bcl 2 PPP1R50 B cell CLL lymphoma 2 apoptosis regulator BCL2 apoptosis regulator Genes bcl 2Zovnishni ID OMIM 151430 MGI 88138 HomoloGene 527 GeneCards BCL2Pov yazani genetichni zahvoryuvannyahronichnij limfolejkoz hronichnij limfolejkozReaguye na spolukunavitoclax navitoclax venetoclaxOntologiya genaMolekulyarna funkciya protein phosphatase binding transcription factor binding protein phosphatase 2A binding channel inhibitor activity protein homodimerization activity channel activity protease binding GO 0001948 GO 0016582 protein binding sequence specific DNA binding BH3 domain binding identical protein binding protein heterodimerization activity ubiquitin protein ligase bindingKlitinna komponenta citoplazma gialoplazma Yaderna membrana membrana mitohondriya klitinne yadro mitohondrialna membrana myelin sheath mitohondrialna zovnishnya membrana endoplazmatichnij retikulum pore complex integral component of membrane vnutrishnoklitinnij endoplasmic reticulum membrane nukleoplazma GO 0009327 protein containing complexBiologichnij proces GO 1904089 negative regulation of neuron apoptotic process intrinsic apoptotic signaling pathway in response to oxidative stress ureteric bud development renal system process organ growth T cell differentiation in thymus lymphocyte homeostasis response to steroid hormone GO 0048554 positive regulation of catalytic activity ear development glomerulus development post embryonic development cellular response to DNA damage stimulus T cell homeostasis negative regulation of ossification GO 1990376 negative regulation of G1 S transition of mitotic cell cycle positive regulation of smooth muscle cell migration regulation of protein localization T cell differentiation B cell lineage commitment response to ischemia regulation of mitochondrial membrane permeability humoral immune response defense response to virus mesenchymal cell development positive regulation of multicellular organism growth animal organ morphogenesis developmental pigmentation hair follicle morphogenesis B cell differentiation proliferaciya metanephros development melanocyte differentiation negative regulation of autophagy positive regulation of neuron maturation negative regulation of myeloid cell apoptotic process cellular response to hypoxia pigment granule organization negative regulation of cell population proliferation B cell receptor signaling pathway cellular response to organic substance regulation of apoptotic process response to cytokine cellular response to glucose starvation regulation of protein stability osifikaciya positive regulation of melanocyte differentiation axon regeneration rozvitok nirki actin filament organization thymus development negative regulation of intrinsic apoptotic signaling pathway negative regulation of apoptotic signaling pathway response to nicotine spleen development endoplasmic reticulum calcium ion homeostasis positive regulation of skeletal muscle fiber development GO 0001306 response to oxidative stress lymphoid progenitor cell differentiation positive regulation of peptidyl serine phosphorylation CD8 positive alpha beta T cell lineage commitment reactive oxygen species metabolic process negative regulation of retinal cell programmed cell death branching involved in ureteric bud morphogenesis gland morphogenesis positive regulation of cell growth positive regulation of B cell proliferation negative regulation of cell growth response to gamma radiation positive regulation of intrinsic apoptotic signaling pathway response to toxic substance digestive tract morphogenesis neuron apoptotic process male gonad development regulation of protein heterodimerization activity regulation of glycoprotein biosynthetic process regulation of viral genome replication zhinocha vagitnist negative regulation of mitochondrial depolarization GO 0016576 protein dephosphorylation protein polyubiquitination cellular calcium ion homeostasis B cell homeostasis behavioral fear response oocyte development regulation of cell matrix adhesion response to iron ion negative regulation of cell migration regulation of autophagy positive regulation of developmental pigmentation developmental growth regulation of transmembrane transporter activity ovarian follicle development regulyaciya ekspresiyi geniv negative regulation of calcium ion transport into cytosol negative regulation of osteoblast proliferation homeostasis of number of cells within a tissue pigmentation response to radiation GO 0048552 regulation of catalytic activity peptidyl threonine phosphorylation regulation of protein homodimerization activity negative regulation of anoikis response to hydrogen peroxide T cell lineage commitment cochlear nucleus development leukocyte homeostasis regulation of programmed cell death regulation of calcium ion transport aksonogeneza negative regulation of cellular pH reduction response to glucocorticoid regulation of cell cycle regulation of mitochondrial membrane potential melanin metabolic process focal adhesion assembly positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway B cell proliferation intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress immune system development apoptotic mitochondrial changes GO 0035404 peptidyl serine phosphorylation regulation of nitrogen utilization GO 0000767 cell morphogenesis positive regulation of cell population proliferation negative regulation of reactive oxygen species metabolic process response to UV B regulation of developmental pigmentation negative regulation of extrinsic apoptotic signaling pathway in absence of ligand extrinsic apoptotic signaling pathway via death domain receptors release of cytochrome c from mitochondria negative regulation of mitotic cell cycle extrinsic apoptotic signaling pathway in absence of ligand GO 0097285 apoptoz transmembrannij transport intrinsic apoptotic signaling pathway in response to DNA damage rist cell cell adhesion cytokine mediated signaling pathway negative regulation of apoptotic process krovotvorennya regulation of growth negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediatorDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez596 12043Ensembl ENSG00000171791 ENSMUSG00000057329UniProt P10415 P10417RefSeq mRNK NM 000633 NM 000657NM 009741 NM 177410RefSeq bilok NP 000624 NP 000648NP 033871 NP 803129Lokus UCSC Hr 18 63 12 63 32 MbHr 1 106 47 106 64 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHKA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak apoptoz alternativnij splajsing Lokalizovanij u yadri membrani mitohondriyi endoplazmatichnomu retikulumi zovnishnij membrani mitohondrij LiteraturaTsujimoto Y Croce C M 1986 Analysis of the structure transcripts and protein products of bcl 2 the gene involved in human follicular lymphoma Proc Natl Acad Sci U S A 83 5214 5218 PMID 3523487 DOI 10 1073 pnas 83 14 5214 Eguchi Y Ewert D L Tsujimoto Y 1992 Isolation and characterization of the chicken bcl 2 gene expression in a variety of tissues including lymphoid and neuronal organs in adult and embryo Nucleic Acids Res 20 4187 4192 PMID 1508712 DOI 10 1093 nar 20 16 4187 Cleary M L Smith S D Sklar J 1986 Cloning and structural analysis of cDNAs for bcl 2 and a hybrid bcl 2 immunoglobulin transcript resulting from the t 14 18 translocation Cell 47 19 28 PMID 2875799 DOI 10 1016 0092 8674 86 90362 4 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Hockenbery D Nunez G Milliman C Schreiber R D Korsmeyer S J 1990 Bcl 2 is an inner mitochondrial membrane protein that blocks programmed cell death Nature 348 334 336 PMID 2250705 DOI 10 1038 348334a0 Yin X M Oltvai Z N Korsmeyer S J 1994 BH1 and BH2 domains of Bcl 2 are required for inhibition of apoptosis and heterodimerization with Bax Nature 369 321 323 PMID 8183370 DOI 10 1038 369321a0PrimitkiZahvoryuvannya genetichno pov yazani z BCL2 pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z BCL2 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 16 lipnya 2017 Procitovano 12 veresnya 2017 angl Arhiv originalu za 13 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 18Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ